PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04014.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 86aa    MW: 9066.07 Da    PI: 7.6482
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04014.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer78.11.2e-241481058
                   ZF-HD_dimer 10 lkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                                  ++NhAa++GghavDGC+Ef+p+ geegt  al+CaACgCHR+FHRr v+
  Zmw_sc04014.1.g00010.1.am.mk  1 QRNHAARMGGHAVDGCREFLPA-GEEGTGGALRCAACGCHRSFHRRVVQ 48
                                  69*******************9.999********************876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257741.0E-13143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.2E-24147IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152322.99146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015668.6E-22145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 86 aa     Download sequence    Send to blast
QRNHAARMGG HAVDGCREFL PAGEEGTGGA LRCAACGCHR SFHRRVVQRC CCCFCRDDTD  60
AVAHAPAAPG RWDCSPESTA SSTTAS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151712.11e-28mini zinc finger 3
SwissprotQ0J5F82e-27MIF4_ORYSJ; Mini zinc finger protein 4
TrEMBLB6U4041e-28B6U404_MAIZE; Mini zinc finger 3
STRINGBGIOSGA028731-PA3e-22(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120