PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03999.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 563aa    MW: 58898 Da    PI: 8.4355
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03999.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.41.6e-28286335251
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Zmw_sc03999.1.g00060.1.am.mk 286 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 335
                                   9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.4E-13283336IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-25284335IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-21286336IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MTAARTWTLP VAMGCHCCCR ERNERQGCAR AIGARWDMEA SSAASPDLSL HISLPNSSAP  60
GSGPAGGRAA AGGAGGGGVG GDPWRRLNWS TELSLSPPAE PDADALPLRH RPSAAASSSA  120
ATTSSVRMMP MPTLQPLDAG GGGGGGGASA APPIRGIPIY NGPGGFPFLP PAAGGDQQKV  180
GFYGSYHHPA TWPSSLGSTS LSPLAPGASP LDPASAFLSP AAHHHHRMLS ASGRLNGMLT  240
DTLRGYGSAG GLGGIGGHHH LHGAQLFGLG SRFMPKLPAK RSMRAPRMRW TSTLHARFVH  300
AVELLGGHER ATPKSVLELM DVKDLTLAHV KSHLQVRDCR PPLPLNSPKT RAFCFVYLLP  360
FLLLFGSDKN TNAVTPELVN DGETDDGWRL AAKKLPFLGG RERGERKMYR TVKSTDKPAA  420
SSGPADGGSG DDEFSGAGQT ASGGDNNMCA RPFGEHRSTS EGAASSVGRG GDMDQSTAGN  480
TSTRWSNSSR DPWMSLNSCN MDAHRLVDLS SPIENAEPCR SSSSQVSNQE PSSPSLEFTL  540
GRPDWQGPPI MNEPAIEELK LKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-14287335351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-14287335351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-14287335351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-14287335351Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025804688.11e-139probable transcription factor RL9
SwissprotQ0J2357e-75ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A3L6DY091e-167A0A3L6DY09_MAIZE; Putative transcription factor RL9
STRINGGRMZM2G082264_P011e-113(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787