PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03997.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 225aa    MW: 24485.2 Da    PI: 7.6987
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03997.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.11.4e-11111166358
                                   XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                                   e +r rr+ +NRe+ArrsR RK+ ++ eL   v  L + N++L +el++    +a 
  Zmw_sc03997.1.g00010.1.am.mk 111 EERRRRRMVSNRESARRSRMRKQRQLSELWAQVSHLRGANRRLLDELNRALRSCAD 166
                                   67899******************************************998777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.8E-9108165No hitNo description
SMARTSM003381.2E-11109173IPR004827Basic-leucine zipper domain
PfamPF001704.4E-9110165IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.599111174IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.33E-10113161No hitNo description
PROSITE patternPS000360116131IPR004827Basic-leucine zipper domain
CDDcd147025.21E-16118165No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MDHNFHGEVA SLRFLSPPNP SFATHHHMNM ALPPQAYFPP SFEPTSPFQE DPATAALLGG  60
DMDHMATFEF DTVVREAAHV VGGNGSPSSG SGSDGGGGGY PLNAAAASAE EERRRRRMVS  120
NRESARRSRM RKQRQLSELW AQVSHLRGAN RRLLDELNRA LRSCADARRE NARLKDEKAE  180
LAKKLEQLLQ APAVATEKSA EAGAYPSIHS CPSGPCNYTS TSTSE
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1125132RRSRMRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025821559.17e-91bZIP transcription factor 2-like
TrEMBLA0A3L6PRK25e-93A0A3L6PRK2_PANMI; G-box-binding factor 1
STRINGPavir.Fb01824.1.p4e-80(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126