PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03984.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 329aa    MW: 35957.4 Da    PI: 6.3772
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03984.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM29.42.2e-091641126
                             NAM  1 lppGfrFhPtdeelvveyLkkkvegk 26
                                    lppGfrFhPtdee+v++yL++k+ ++
  Zmw_sc03984.1.g00050.1.sm.mkhc 16 LPPGFRFHPTDEEIVTHYLTPKALDR 41
                                    79*******************98776 PP

2NAM912.1e-285011564129
                             NAM  64 rdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     +d+ky+tg+r+nrat+sgyWkatgkdke+++ +g lvg+kktLvfy+grap+gekt+Wvmhe+rle
  Zmw_sc03984.1.g00050.1.sm.mkhc  50 EDRKYPTGTRTNRATESGYWKATGKDKEIFRGRGVLVGMKKTLVFYRGRAPRGEKTEWVMHEFRLE 115
                                     689************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100532.3981138IPR003441NAC domain
SuperFamilySSF1019411.7E-448138IPR003441NAC domain
PfamPF023651.0E-2317114IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MSEVSVINQT AGQLELPPGF RFHPTDEEIV THYLTPKALD RFFTSGIIGE DRKYPTGTRT  60
NRATESGYWK ATGKDKEIFR GRGVLVGMKK TLVFYRGRAP RGEKTEWVMH EFRLEGKLPQ  120
PLPRSAKDEW AVCKVVNKEL LAAKPGASIV TAGAEIERVG SLGFISDLLD SAAELPPLMD  180
PTFGADVDEV IDFKGLASTS TSGHGAAPGG VSYLPVKTEE QYLHHHQQPQ STPMFYTGSS  240
PYFSLPEVNS GDIQTAIRRY CKAEQVASGQ TTSVVSPSRE TGLSTDPNAA AGYAEISSAA  300
TPSSSHHHHH PFLQELDDPV LNLADIWKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A3e-331314414171NO APICAL MERISTEM PROTEIN
1ut4_B3e-331314414171NO APICAL MERISTEM PROTEIN
1ut7_A3e-331314414171NO APICAL MERISTEM PROTEIN
1ut7_B3e-331314414171NO APICAL MERISTEM PROTEIN
4dul_A3e-331314414171NAC domain-containing protein 19
4dul_B3e-331314414171NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984514.11e-169NAC domain-containing protein 79
TrEMBLA0A368SRF41e-167A0A368SRF4_SETIT; Uncharacterized protein
STRINGPavir.Ib01526.1.p1e-169(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104