PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03975.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 603aa    MW: 63640.1 Da    PI: 9.8786
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03975.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.82e-40111187177
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                   +CqvegC++ l+ akeyhrrhkvCe+hskap v+v g eqrfCqqCsrfh+lsefD++krsCrrrLa+hnerrrk++
  Zmw_sc03975.1.g00030.1.am.mk 111 RCQVEGCHVLLAGAKEYHRRHKVCEAHSKAPRVVVLGAEQRFCQQCSRFHALSEFDDAKRSCRRRLAGHNERRRKSS 187
                                   6**************************************************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.6E-33105173IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.505109186IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.11E-38110189IPR004333Transcription factor, SBP-box
PfamPF031101.0E-31112185IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MDGNGGGSGT ATPSWDPGTH WAPAGSSGYP QPFAPRLGSG PSRDQQQHQQ EQTWLNLGKQ  60
PCCWAGAGGN QQGPQPSSWG HVHGNGGGTG GGSEAAAAAE GKRKEKAAAP RCQVEGCHVL  120
LAGAKEYHRR HKVCEAHSKA PRVVVLGAEQ RFCQQCSRFH ALSEFDDAKR SCRRRLAGHN  180
ERRRKSSASE TMARTVGHSH GLMPFGHGFF PSSPAGALSL LSSARGGGAP WLIPATADIS  240
TRSSAALDEL IAENRRALLA WQFFSEHSPA GRLVPSSSTG RVLPAGEVPA GWHTAQIQDH  300
PGGGGGRADD RYSFSEAPAG AGHTTLDLMQ TPDTSAGAPF LKPVSERAGS ARTPRKDGGD  360
AGCTSVDAWA SAEGAPDRVH RCPPRPARAE SQKRSGSSSV VSLNHQLQSR RRRGRRPSQT  420
NGGERLITVP TCRSELWDDG ASYVSPRSAM MAIMASPMRG SAIGFGKCGP YVVCKESHKR  480
ETTYAAMAGP SAFRFVALIA VMSILSLLAF PVSCHEDPAA EVTDESRQNT TTRRQAWAAA  540
ARGYGGWSYG GATWYGSPYG AGGDGFVGRS LCASGKRERG CIGRGGMVIF VPPRPLLELL  600
LPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-291121851184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00290DAPTransfer from AT2G33810Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978167.11e-115squamosa promoter-binding-like protein 7
SwissprotQ7XT421e-102SPL7_ORYSJ; Squamosa promoter-binding-like protein 7
TrEMBLA0A0A9F9311e-120A0A0A9F931_ARUDO; Uncharacterized protein
STRINGSi010262m1e-115(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP103033439
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]