PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03922.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 809aa    MW: 87245.9 Da    PI: 10.7757
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03922.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.42.8e-532043321128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sg
  Zmw_sc03922.1.g00070.1.am.mk 204 LPPGFRFHPTDEELVVHYLKKKTASMPLPV-TIIAEVDLYKFDPWELPAKASFGEHEWYFFSPRDRKYPNGARPNRAATSG 283
                                   79****************************.89***************9989999************************** PP

                           NAM  82 yWkatgkdkevlsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatg+dk++l++  ++++vg+kk Lvfy+g+ pkg kt+W+mheyrl
  Zmw_sc03922.1.g00070.1.am.mk 284 YWKATGTDKPILASdgSRQKVGVKKALVFYRGKPPKGIKTNWIMHEYRL 332
                                   ************99777788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.28E-63200371IPR003441NAC domain
PROSITE profilePS5100561.565204371IPR003441NAC domain
PfamPF023653.2E-27205332IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 809 aa     Download sequence    Send to blast
MLCLPVPRDP AKSGAHSAGA AVTDDPELSL LLQPPLCCSY FSKPPQKTAG PATLLLITRP  60
VRVDAPSCGS GSVHGSRAAT WASRPGFARV TGTARARGCG RWLADTGYGW RRANVSSGER  120
PGPLASVSGQ LSSLHRRKRD PKPPAKIPAR ITRPPASPPA RPNRHRNKPG PPRRCPTMRS  180
MESTDSSSGS ALPQQKQPGP APHLPPGFRF HPTDEELVVH YLKKKTASMP LPVTIIAEVD  240
LYKFDPWELP AKASFGEHEW YFFSPRDRKY PNGARPNRAA TSGYWKATGT DKPILASDGS  300
RQKVGVKKAL VFYRGKPPKG IKTNWIMHEY RLTDAASFAN TSRPPPGSGG GGKTAASLRL  360
DDWVLCRIYK KVNKHGEFGD QLRSMECGED SVEDAVAAAY HPSTHAAAGN MAIAGGGNYT  420
SLLHHDDNNF LDGLLTVEDG GLSGAATSSL RQIAAAARAG PAVTKQLLVP ASAPFNWLDA  480
SAIAILPSPK RYHGFSREAT DGGSSSLSSP AERNHLAAPG AGTIDGGTTA AIPTFLNPLG  540
VQVQQSAAFH HHANILGTSL PPETASCAFQ NPYQFSGVNW NPPLHADFHR STSASCVAAR  600
ALYGRQHDRL PAGLPALPSR SINPSRASKN VAAAHPQQSR RNGMTPRGSL ACMAREAAGA  660
PAAGRAPRRG RRKIMPPVEE SSASVRARQR LFLEGSIISV RRSRCAIERP RLPRSAHRRL  720
SGVSRCAFPD LGSLARVCGW RRSWLRAWFR FSPRPALVDA FERRHIDETS MAAHEGRAIE  780
DSRIDQPVES MPEIFVAGRV YSYEEMRTS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-6719437110168NAC domain-containing protein 19
3swm_B5e-6719437110168NAC domain-containing protein 19
3swm_C5e-6719437110168NAC domain-containing protein 19
3swm_D5e-6719437110168NAC domain-containing protein 19
3swp_A5e-6719437110168NAC domain-containing protein 19
3swp_B5e-6719437110168NAC domain-containing protein 19
3swp_C5e-6719437110168NAC domain-containing protein 19
3swp_D5e-6719437110168NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00058PBMTransfer from AT1G61110Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025802635.10.0NAC transcription factor NAM-B2-like
TrEMBLA0A0H4KD060.0A0A0H4KD06_MAIZE; NAC transcription factor
STRINGPavir.J08552.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75723649