PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03866.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family ZF-HD
Protein Properties Length: 85aa    MW: 8967.01 Da    PI: 7.9442
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03866.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer80.12.8e-251471158
                   ZF-HD_dimer 11 kNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58
                                  +NhAa++Gg avDGC+Ef+p+ geegt  al+CaACgCHR+FHRr v+
  Zmw_sc03866.1.g00010.1.am.mk  1 RNHAARMGGLAVDGCREFLPA-GEEGTGGALRCAACGCHRSFHRRVVQ 47
                                  8*******************9.999********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015661.5E-20144IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047701.3E-23146IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152321.971145IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257748.0E-13142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 85 aa     Download sequence    Send to blast
RNHAARMGGL AVDGCREFLP AGEEGTGGAL RCAACGCHRS FHRRVVQRRC CCFCRDDTDA  60
VAHAPAAPGR WDCSPESTAS STTAS
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015649658.15e-24mini zinc finger protein 4
SwissprotQ0J5F85e-25MIF4_ORYSJ; Mini zinc finger protein 4
TrEMBLB6U4041e-25B6U404_MAIZE; Mini zinc finger 3
STRINGOGLUM08G16680.12e-23(Oryza glumipatula)
STRINGOS08T0438100-019e-24(Oryza sativa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]