PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03834.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 636aa    MW: 70237.5 Da    PI: 7.3106
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03834.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS365.66.7e-1122636341373
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   l++lL++cA+av+++d + a++lL++++++asp+gd +qRla++f+e+L+arla+++s +y++l +++ts    +  l+a+
  Zmw_sc03834.1.g00010.1.am.mk 263 LRTLLIHCAQAVATDDRRSATELLKQIKQHASPQGDGTQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AVALLQAY 340
                                   6789************************************************************999998...899***** PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   +l+  +  + k++++  N +I++a  g++++Hi+D++i++G+QWp++l+ +++R++gpp++RiTg++ p++g   +e++ee
  Zmw_sc03834.1.g00010.1.am.mk 341 QLYMAAICFKKMAFIFSNYTIYNASLGKKKIHIVDYGIQYGFQWPCFLRRISCREGGPPEVRITGIDLPQPGfrPTERIEE 421
                                   ***********************************************************************9********* PP

                          GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                                   tg+rL ++A+e+gvpf++++++a+++e+++ e+L ++p+E+l+Vn+++q  +l+desv +es+rd vL+ +++++P+ +++
  Zmw_sc03834.1.g00010.1.am.mk 422 TGRRLGNYAREFGVPFKYHAIAASKMESIRKEDLTIDPDEVLIVNCMYQFRNLMDESVVIESPRDVVLNNIRKMQPHAFIH 502
                                   ********************************************************************************* PP

                          GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                   +  + + +++ F++rf eal yysalfd l+++ pr+s++r+ +E+ ++gr + nv+aceg++r+er et+++W+ r ++a
  Zmw_sc03834.1.g00010.1.am.mk 503 AIVNGSFSAPFFVTRFREALFYYSALFDILDTTTPRNSDQRMLIEQNIFGRTALNVIACEGTDRVERPETYKQWQVRNQRA 583
                                   ********************************************************************************* PP

                          GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                   G+k++pl++++++ +++ ++ ++ + + ++ ++++l++gWk+r L+++S W
  Zmw_sc03834.1.g00010.1.am.mk 584 GLKQLPLNQEIVQVVRSKVKDCYHKDFVIDVDHNWLLQGWKGRILYAISTW 634
                                   ***********************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098563.143237615IPR005202Transcription factor GRAS
PfamPF035142.3E-109263634IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 636 aa     Download sequence    Send to blast
TRVFPPSSNL PLPCLQSLLP SRLPASRSRP GDLNSSFPLP PPSPHAAAAM GSSFYDPSPA  60
GAADPSLYFY LPDLVPDSPS SYLDLPPTTH HQQPPVSSDG GGGNGATGSP EDLVLPYISR  120
MLMEDDIEDK FFYDYPDNPA LLQAQQPFLD ILSNSDDSSA TTGDKVAARS DGPFAPAPPP  180
PSAASVKEEG LVNAAPGAGV SRGRKNPYDD DELEAESGRS SKQSAQMQQL RIAMQEEAAK  240
NEAGGKAGNG KANGRGGRKV VDLRTLLIHC AQAVATDDRR SATELLKQIK QHASPQGDGT  300
QRLAHCFAEG LQARLAGTGS MVYQSLMAKR TSAVALLQAY QLYMAAICFK KMAFIFSNYT  360
IYNASLGKKK IHIVDYGIQY GFQWPCFLRR ISCREGGPPE VRITGIDLPQ PGFRPTERIE  420
ETGRRLGNYA REFGVPFKYH AIAASKMESI RKEDLTIDPD EVLIVNCMYQ FRNLMDESVV  480
IESPRDVVLN NIRKMQPHAF IHAIVNGSFS APFFVTRFRE ALFYYSALFD ILDTTTPRNS  540
DQRMLIEQNI FGRTALNVIA CEGTDRVERP ETYKQWQVRN QRAGLKQLPL NQEIVQVVRS  600
KVKDCYHKDF VIDVDHNWLL QGWKGRILYA ISTWGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-452676348374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664663.20.0PREDICTED: scarecrow-like protein 9, partial
SwissprotO809331e-162SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0D3HVY80.0A0A0D3HVY8_9ORYZ; Uncharacterized protein
STRINGOB12G23410.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297