PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03806.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 478aa    MW: 51707.7 Da    PI: 7.9067
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03806.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.52.2e-52932211128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat
  Zmw_sc03806.1.g00010.1.am.mk  93 VPPGFRFHPTEEELLNYYLRKKVASQEIDL-DVIRDVDLNKLEPWDIQEkcKIGSgPQNDWYFFSHKDKKYPTGTRTNRAT 172
                                   69****************************.9***************952444443456********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   ++g+Wkatg+dk++++   + +g++ktLvfykgrap+g+k+dW+mheyrl
  Zmw_sc03806.1.g00010.1.am.mk 173 AAGFWKATGRDKTIYN-AVKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 221
                                   ****************.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-5887255IPR003441NAC domain
PROSITE profilePS5100556.8393255IPR003441NAC domain
PfamPF023655.9E-2894221IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 478 aa     Download sequence    Send to blast
MDGAIDKSTD GSSPGFFSAL LDYIRPHLSS SATSFFFLLL LQLFFLPLAR THTSCYRAQP  60
RTSRTRKKQC IYTHRVREKE RSMSISVNGQ SCVPPGFRFH PTEEELLNYY LRKKVASQEI  120
DLDVIRDVDL NKLEPWDIQE KCKIGSGPQN DWYFFSHKDK KYPTGTRTNR ATAAGFWKAT  180
GRDKTIYNAV KRIGMRKTLV FYKGRAPHGQ KSDWIMHEYR LDDPADAAST VTAAAVASSD  240
AGQEDGWVVC RVFKKKHHVK ESGSGSGGGK HGHHHGGGGD HGSKMAAAHG HGLQYSSSDD  300
ALDQILQYMG RSCKQEHEIL SPSAGGSGRP AGSRCHLRPI ETVLGEHGFM KLPPLESPSA  360
ATTALTPPPP HVPGEAAASS GGDDLLLHRG GNGITDWAMM DRLVASHLNG QAPDAPVDHH  420
LCSFDGGDDD AGSADGLAFY SAAATRLLSG GSGSGASDDD LWSFARSAAS SSTERLIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-479025614166NO APICAL MERISTEM PROTEIN
1ut4_B2e-479025614166NO APICAL MERISTEM PROTEIN
1ut7_A2e-479025614166NO APICAL MERISTEM PROTEIN
1ut7_B2e-479025614166NO APICAL MERISTEM PROTEIN
4dul_A2e-479025614166NAC domain-containing protein 19
4dul_B2e-479025614166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020164672.11e-177NAC domain-containing protein 43-like
SwissprotQ84WP61e-117NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A3B6RKJ30.0A0A3B6RKJ3_WHEAT; Uncharacterized protein
TrEMBLA0A446XJ840.0A0A446XJ84_TRITD; Uncharacterized protein
STRINGMLOC_66924.21e-177(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]