PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03769.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 669aa    MW: 72645.8 Da    PI: 11.0648
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03769.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM166.97e-52221511128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhP+dee++++yL++kv ++++++ ++i e+di+k+ePw+Lp+k+k +ekewyf+s +  ky++g+r+nratk+g
  Zmw_sc03769.1.g00050.1.am.mk  22 LPPGFRFHPSDEEIITFYLRPKVINNRFTA-HAIGEADINKCEPWELPEKAKMGEKEWYFYSLKGLKYPSGSRANRATKAG 101
                                   79*************************999.88***************99999**************************** PP

                           NAM  82 yWkatgkdkevlskkgel...vglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatgkd+e++++++++   vg+kktLvfykgrap+g ktdWvmhe+rl
  Zmw_sc03769.1.g00050.1.am.mk 102 YWKATGKDREIYQATSKKpvlVGMKKTLVFYKGRAPTGDKTDWVMHEFRL 151
                                   *************85554566***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.2E-5518156IPR003441NAC domain
PROSITE profilePS5100552.18522178IPR003441NAC domain
PfamPF023651.9E-2523151IPR003441NAC domain
Gene3DG3DSA:3.40.50.23002.1E-8603658No hitNo description
SuperFamilySSF521723.7E-7604661IPR011006CheY-like superfamily
PROSITE profilePS5011012.139605669IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.62E-5607669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 669 aa     Download sequence    Send to blast
MADHQQQQWR TSDDTNSGGL KLPPGFRFHP SDEEIITFYL RPKVINNRFT AHAIGEADIN  60
KCEPWELPEK AKMGEKEWYF YSLKGLKYPS GSRANRATKA GYWKATGKDR EIYQATSKKP  120
VLVGMKKTLV FYKGRAPTGD KTDWVMHEFR LDGSGKLPHP AASSSSSTGI VMKSSFQRSM  180
SFPLPMQFSM GPEDFAGGSN TLRHIMDPSP GEVLARKTGS LIAADPEPVI AYAVAEMRSA  240
RHHGRTKVEQ SPVTGENRTE GSVRPAESPC RRTSTTVLDA PAPPGPAALG VPTAGYCWRP  300
RVPRCRLRRV QSIGRAGAAL ARRIPSRVLS GTQAGARSSL TRRSSSVTHP LLQCGTVTRS  360
AAERAPSVLL KKLLDHRRLP VASNGSARVA ADVLPHGFLT RGSDSQAFHD ALYLLALFRK  420
DPVLARRAAL EKFGARSRFG CQCRYAVTVF LSNGGSWLAT PGPGGHVPPP SSSEDGRTRS  480
FFSRKRFHFG RTNTRARVDP PRTARIRYLE DSLAAQLTRD LLDDRLAICF RIRQAAGSPR  540
AYITAPPGPG RGGTRRRRSS SQCSLHSAFV DVSECLVSFG VQMSTVGGAV VAPAAKAGGG  600
AGTPHVLAVD DSSVDRAVIA AILRSSRFRV TAVESGKRAL ELLGSESSEL KQIPVVIMSS  660
ENVPTRISR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-412015718157NAC domain-containing protein 19
3swm_B2e-412015718157NAC domain-containing protein 19
3swm_C2e-412015718157NAC domain-containing protein 19
3swm_D2e-412015718157NAC domain-containing protein 19
3swp_A2e-412015718157NAC domain-containing protein 19
3swp_B2e-412015718157NAC domain-containing protein 19
3swp_C2e-412015718157NAC domain-containing protein 19
3swp_D2e-412015718157NAC domain-containing protein 19
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP3311234