PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03765.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 179aa    MW: 20088.5 Da    PI: 8.6494
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03765.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_136.79.3e-1281137359
                                   XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 
                                   e +r rr+ +NRe+ArrsR RK+ ++ eL   v  L + N++L +el++    ++ +
  Zmw_sc03765.1.g00060.1.sm.mk  81 EERRRRRMVSNRESARRSRMRKQRQLSELWAQVVYLRGANRRLLDELNRAIRDCSDV 137
                                   67899******************************************9987777765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1704.2E-1074136No hitNo description
SMARTSM003382.4E-1279143IPR004827Basic-leucine zipper domain
PfamPF001701.9E-980137IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.47381144IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.88E-1083132No hitNo description
PROSITE patternPS00036086101IPR004827Basic-leucine zipper domain
CDDcd147027.75E-1588135No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MLHQHHYHGG LASLHCLPPP DPAFHAHYHS NMITMVPSSF NFSPAAHEPI CEAPAVAGKS  60
SAGYGGVEDV YSSHSTVMAE EERRRRRMVS NRESARRSRM RKQRQLSELW AQVVYLRGAN  120
RRLLDELNRA IRDCSDVRCE NARLEKEKAE LNTKLQGLTQ AQNTTMPSST GPHDDTATA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195102RRSRMRKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025799413.18e-81bZIP transcription factor 2-like
TrEMBLA0A2T7ETI38e-80A0A2T7ETI3_9POAL; Uncharacterized protein
STRINGPavir.Ba01782.1.p4e-75(Panicum virgatum)
STRINGPavir.Bb02514.1.p2e-74(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126