PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03692.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 498aa    MW: 54104 Da    PI: 7.646
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03692.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS2522.2e-77914914374
                          GRAS   4 lLlecAeavssgdlelaqalLarlselaspdgd.pmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                    +l+c+ +++ g++ +a+a+L+ ls  +s +gd ++qR++  f+eAL +r ++  ++l+ +l+ +   +  +   +++ + 
  Zmw_sc03692.1.g00060.1.am.mk  91 IILQCVACLDMGNAVAASAALQYLSSVVSFAGDvALQRVVLAFAEALGRRAMQLLPGLAWSLQLKVLLPPPTPAYINSAQW 171
                                   689*****************************559************************9998776665555555555555 PP

                          GRAS  84 .fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetge 163
                                    f  ++P+++++  +aN+aI ea++ e+rvH++D++  ++ QW+aL++ +a+R++gpp lR+T v++    ++  l++ + 
  Zmw_sc03692.1.g00060.1.am.mk 172 sFAMLFPLIRVAATAANNAIKEATAAERRVHVVDLGGANPNQWLALIRLFAARSGGPPFLRLTIVNE----DQSFLSQAAG 248
                                   5******************************************************************....99******** PP

                          GRAS 164 rLakfAeelgvpfefnvl..vakrledleleeLrvkp..gEalaVnlvlqlhrll.........................d 215
                                    L++ A +l+vpf fn++  + +r++  ++ +L v +  +Eal++ + lq hrl                           
  Zmw_sc03692.1.g00060.1.am.mk 249 VLTQEAVRLHVPFVFNPVqdHIDRFTPASVAALGVAQgrDEALVITSTLQFHRLIadkvtedlpaesrnkkrknvdtttaT 329
                                   *****************8666677777799999999999************************************988644 PP

                          GRAS 216 esvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivn 296
                                    s++++ + d++L+++ +l Pk++v++eq+a+hn++ + +r+ +a++yy +lf  lea  + +  +r +vE++ll++e +n
  Zmw_sc03692.1.g00060.1.am.mk 330 TSHEIT-KADALLRVLCDLTPKLMVLTEQDANHNDQVLSNRVRNAIDYYEVLFRDLEAA-GGDPMTREFVEHMLLKEEMKN 408
                                   444444.59***********************************************999.7888***************** PP

                          GRAS 297 vvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrve.....eesgslvlgWkdrpLvsvSa 372
                                   +++cega rrerhe+le W  r++ aGF+ +++s++a k++ +l ++ ++dg ++       ++g+l+l+ ++ ++++vSa
  Zmw_sc03692.1.g00060.1.am.mk 409 IISCEGALRRERHEKLEYWFPRMKVAGFELAAVSDDAFKDVASLAHQLSGDGIKWTlgahkIDKGCLLLYSRKISIFAVSA 489
                                   ****************************************************999877665669***************** PP

                          GRAS 373 Wr 374
                                   W+
  Zmw_sc03692.1.g00060.1.am.mk 490 WQ 491
                                   *6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098537.87462466IPR005202Transcription factor GRAS
PfamPF035147.7E-7591491IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 498 aa     Download sequence    Send to blast
MSSNQSRGSG KAVVAKEEDA EQEIWLVRKK VHHQGGGPSC AGEESSSLSA PAQPAANQGA  60
KAPVEAVPVP DANVPGPQPH GGNLSIFFYN IILQCVACLD MGNAVAASAA LQYLSSVVSF  120
AGDVALQRVV LAFAEALGRR AMQLLPGLAW SLQLKVLLPP PTPAYINSAQ WSFAMLFPLI  180
RVAATAANNA IKEATAAERR VHVVDLGGAN PNQWLALIRL FAARSGGPPF LRLTIVNEDQ  240
SFLSQAAGVL TQEAVRLHVP FVFNPVQDHI DRFTPASVAA LGVAQGRDEA LVITSTLQFH  300
RLIADKVTED LPAESRNKKR KNVDTTTATT SHEITKADAL LRVLCDLTPK LMVLTEQDAN  360
HNDQVLSNRV RNAIDYYEVL FRDLEAAGGD PMTREFVEHM LLKEEMKNII SCEGALRRER  420
HEKLEYWFPR MKVAGFELAA VSDDAFKDVA SLAHQLSGDG IKWTLGAHKI DKGCLLLYSR  480
KISIFAVSAW QPAKKTSK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439698.11e-118hypothetical protein SORBIDRAFT_09g018540
TrEMBLK3ZDF11e-129K3ZDF1_SETIT; Uncharacterized protein
STRINGSi024587m1e-129(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137161330