PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03677.1.g00170.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 388aa    MW: 42762.4 Da    PI: 10.4953
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03677.1.g00170.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM805.2e-252810254128
                           NAM  54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   e + w+fF++r++ +a+g r++r+t +gyWka g+  +v++++++++g++kt+vfy+grap+g+kt+W m+eyr+
  Zmw_sc03677.1.g00170.1.am.mk  28 EGEPWFFFCPRQEGEARGGRPSRVTPTGYWKAAGTPAAVYAADRRAIGVRKTMVFYRGRAPSGTKTTWKMNEYRA 102
                                   5678*********************************************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100529.1751143IPR003441NAC domain
PfamPF023652.1E-1321101IPR003441NAC domain
SuperFamilySSF1019413.66E-2626141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MHWSPLKTRR RAALGAEIHE RLCGGAGEGE PWFFFCPRQE GEARGGRPSR VTPTGYWKAA  60
GTPAAVYAAD RRAIGVRKTM VFYRGRAPSG TKTTWKMNEY RALQYDAGGT AEYGSSSSAH  120
AASPLSLPSQ LRSEFSLCRL YTRSGVLRQF DRRPLAGAAS CPGEGPAEPS MATAASLDDD  180
DGSGGSKQQQ MQLMEREGTL NVPGILDREE RTGAVDHVRF TCRAQALDHH FLPGRVPSRE  240
AHSCRQCTSR ESERGRPLGA ALDDRAMQLL RCSDVQSGTR LPARTAHSPV SSLASLPRPI  300
FHGLVEWIWI PGRMEWQVRF RDSVLLSAHF CRRGALPLSL CTFPEVDSLG NQQRGTTATT  360
RVSLRLRFPE GAAQRTANKS RLKLNMIR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-172710469144NO APICAL MERISTEM PROTEIN
1ut4_B1e-172710469144NO APICAL MERISTEM PROTEIN
1ut7_A1e-172710469144NO APICAL MERISTEM PROTEIN
1ut7_B1e-172710469144NO APICAL MERISTEM PROTEIN
3swm_A2e-172710472147NAC domain-containing protein 19
3swm_B2e-172710472147NAC domain-containing protein 19
3swm_C2e-172710472147NAC domain-containing protein 19
3swm_D2e-172710472147NAC domain-containing protein 19
3swp_A2e-172710472147NAC domain-containing protein 19
3swp_B2e-172710472147NAC domain-containing protein 19
3swp_C2e-172710472147NAC domain-containing protein 19
3swp_D2e-172710472147NAC domain-containing protein 19
4dul_A1e-172710469144NAC domain-containing protein 19
4dul_B1e-172710469144NAC domain-containing protein 19