PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03676.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 407aa    MW: 45144.5 Da    PI: 10.3494
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03676.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP69.66e-22326378153
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 
                                   +CqvegC  dl  akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsr+  ls
  Zmw_sc03676.1.g00010.1.am.mk 326 RCQVEGCGLDLGGAKEYHRKHRVCEAHTKCPRVVVAGQERRFCQQCSRWVCLS 378
                                   6***********************************************98775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.6E-22320376IPR004333Transcription factor, SBP-box
PROSITE profilePS5114118.384324401IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-20325378IPR004333Transcription factor, SBP-box
PfamPF031102.5E-16327378IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 407 aa     Download sequence    Send to blast
VLFLTPEVRS LSLSVPLGGE VAAPSSEERC AVLFVWAEFT SEATQGMKRA QSNTLDNWAW  60
QRCLVYLSKS FLVAAAPCLL RPVFCSSCAT HFSEKTFSCT PPRSNHFAAR KREGSLLDLS  120
RCGRRRKTRP VPSLSPGRRR TTVHPRPDRA RVGCCFLERP SDPVDDGRDR SLRRQLAGRS  180
RRILAWLGSL VERFVVAWRR RCCRWPRPWP PPPTYYLLDD AWLGKWNRLR TVNSRGIDLS  240
AGRSAHCSSL RSPNQPRIAQ AESAMEWTVP KPAASPSSPP LLWDWGDSAA PASGSSGEAP  300
ARRGGKEREG KRAKGGEDGG GGGEVRCQVE GCGLDLGGAK EYHRKHRVCE AHTKCPRVVV  360
AGQERRFCQQ CSRWVCLSCC FQFPGRRSSA VDLVDPCRAA NSRLSCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A8e-14322374153squamosa promoter-binding protein-like 12
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109126RKREGSLLDLSRCGRRRK
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952