PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03620.1.g00100.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 347aa    MW: 39184.6 Da    PI: 6.7435
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03620.1.g00100.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1676.2e-52101391128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPtdeel+ +yL+kkv+ ++++l +vi+e+d++k+ePwdL+   ++ +  ++ewyfFs++dkky+tg+r+nrat
  Zmw_sc03620.1.g00100.1.am.mk  10 VPPGFRFHPTDEELLYYYLRKKVAYEPIDL-DVIREIDLNKLEPWDLKDrcRIGTgPQNEWYFFSHKDKKYPTGTRTNRAT 89 
                                   69****************************.9***************943444442456********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                    +g+Wkatg+dk+++  +   +gl+ktLvfy grap+g+ktdW+mheyrl
  Zmw_sc03620.1.g00100.1.am.mk  90 MAGFWKATGRDKAIFLGNAGRIGLRKTLVFYIGRAPHGKKTDWIMHEYRL 139
                                   ****************9999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-584159IPR003441NAC domain
PROSITE profilePS5100557.53210159IPR003441NAC domain
PfamPF023653.7E-2711139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003002Biological Processregionalization
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010455Biological Processpositive regulation of cell fate commitment
GO:0048829Biological Processroot cap development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 347 aa     Download sequence    Send to blast
MHPSSGSMSV PPGFRFHPTD EELLYYYLRK KVAYEPIDLD VIREIDLNKL EPWDLKDRCR  60
IGTGPQNEWY FFSHKDKKYP TGTRTNRATM AGFWKATGRD KAIFLGNAGR IGLRKTLVFY  120
IGRAPHGKKT DWIMHEYRLD EENVEVQEDG WVVCRVFKKK NYQRGFNPAE MAMVDDDELP  180
PLPVPVPGSM PAEHKQNPHL MHYDFPSFDP SMQLPQLMNA DQPVAALLSG QPSIAMGMSS  240
LDVECSQNLM KLTANSSQEM LHEGGGGGVD RFIPGTTDWS ILDKLLASHQ NLDQLFQGKQ  300
LVTAASAAPM APYHQQLMEL SDTSSSLQRL PLRYLGGQAA DNLRFPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A8e-51816115167NO APICAL MERISTEM PROTEIN
1ut4_B8e-51816115167NO APICAL MERISTEM PROTEIN
1ut7_A8e-51816115167NO APICAL MERISTEM PROTEIN
1ut7_B8e-51816115167NO APICAL MERISTEM PROTEIN
3swm_A9e-51816118170NAC domain-containing protein 19
3swm_B9e-51816118170NAC domain-containing protein 19
3swm_C9e-51816118170NAC domain-containing protein 19
3swm_D9e-51816118170NAC domain-containing protein 19
3swp_A9e-51816118170NAC domain-containing protein 19
3swp_B9e-51816118170NAC domain-containing protein 19
3swp_C9e-51816118170NAC domain-containing protein 19
3swp_D9e-51816118170NAC domain-containing protein 19
4dul_A8e-51816115167NAC domain-containing protein 19
4dul_B8e-51816115167NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00250DAPTransfer from AT1G79580Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965525.10.0NAC domain-containing protein 76
SwissprotQ5Z6B61e-122NAC76_ORYSJ; NAC domain-containing protein 76
TrEMBLK3Y0W10.0K3Y0W1_SETIT; Uncharacterized protein
STRINGSi007822m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34613781
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]