PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03572.1.g00090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 1247aa    MW: 140331 Da    PI: 6.2484
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03572.1.g00090.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS271.62.4e-832335943364
                          GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalkl 83 
                                   +lLl+cAeav++++ + a +lL++++++as +gd+ qRla++f ++L+arl++++++l + +++++ s   ++e ++a++l
  Zmw_sc03572.1.g00090.1.am.mk 233 TLLLHCAEAVAANNRTVAGELLKQIKHNASATGDARQRLAQCFSKGLEARLLGTGNQLWSLVAAERPS---VVELAKAYRL 310
                                   68*********************************************************999888888...9********* PP

                          GRAS  84 fsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLa.sRpegppslRiTgvgspesg..skeeleet 161
                                      ++ + k++++   ++I++a+ g++rvH++D+++++G++W+ L+  +a +R++  ++l+iT++g ++    s++ +ee 
  Zmw_sc03572.1.g00090.1.am.mk 311 SMAACCFSKVAFIFSIKTIMDAAVGKSRVHVVDYGMNYGFHWAELICLMAkDRDGARAELKITAIGCSRRMfwSAQGIEEQ 391
                                   **************************************************78889999********988879********* PP

                          GRAS 162 gerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvv 240
                                   g+rL+k A+e+g+pf+f+ ++++++e++++++L+ + gE+l+Vn +++ ++l+des+  ++  +rd vL+ +++++P+v++
  Zmw_sc03572.1.g00090.1.am.mk 392 GRRLRKCASEFGLPFKFHSITTTNWENVRIQDLNADIGEVLIVNDMYNFMTLMDESMLFDEpsPRDIVLSNIRNMRPDVFI 472
                                   ********************************************************98776669***************99 PP

                          GRAS 241 vveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerlee 321
                                    +  +++ n++sFl rf eal yy+alfd ++a++pr+se r ++E+ellg+++ nvvaceg++   r e++++ ++r ++
  Zmw_sc03572.1.g00090.1.am.mk 473 QSIVNSS-NGGSFLSRFREALFYYTALFDVFDATMPRQSESRLVLEQELLGNHLLNVVACEGRDLMGRPEKYRQCQARNQR 552
                                   8877654.899********************************************************************** PP

                          GRAS 322 aGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkd 364
                                   aG+k++pl+  ++k +k  ++++++d +++ e+ ++l++gW+ 
  Zmw_sc03572.1.g00090.1.am.mk 553 AGLKQLPLKPGIVKGIKEFVKTHHKD-FMLGEDGQWLLQGWMA 594
                                   ************************77.**************85 PP

2GRAS285.41.7e-8788112392373
                          GRAS    2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaa 80  
                                      lLl+cAe v ++ ++ a++lL++++ +asp+gd++qRla+yf+eAL++rl++++ + +      + + ++ ++ l+a
  Zmw_sc03572.1.g00090.1.am.mk  881 HALLLRCAETVMDDGHRGARELLEKIKRHASPTGDATQRLAHYFAEALETRLTGMGAHRS------SFTIQQPVRFLKA 953 
                                    579***************************************************544443......3333446799*** PP

                          GRAS   81 lklfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skee 157 
                                    + l+  ++ + k++++ +N+ I++a++g +r+Hi+D+++ +G+QWp Ll+ La+R++gpp++ iTg++  ++    ++ 
  Zmw_sc03572.1.g00090.1.am.mk  954 YPLYIATCCFNKVAFMFCNRSIYQAAAGRSRLHIVDYGVCHGFQWPVLLRWLAAREGGPPQVTITGIVLTKHWyrPSDH 1032
                                    *********************************************************************666699**** PP

                          GRAS  158 leetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvksl 234 
                                    +eetg+rL++ A+elgvpf+f++++a ++++++le+L+v+p+ alaVn+ ++l+ + d+sv ++   +rd vL  ++++
  Zmw_sc03572.1.g00090.1.am.mk 1033 IEETGHRLSNCARELGVPFKFQAIMAAKWDAVRLEDLNVDPDAALAVNSLFSLEMMDDDSVVVDRasPRDVVLGNIRRM 1111
                                    *********************************************************99987766669*********** PP

                          GRAS  235 sPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetle 313 
                                    +P v+++   +  + ++sFl+rf e+l +ysa+           se+r ++E  +lg  + n++aceg++r+ r e+++
  Zmw_sc03572.1.g00090.1.am.mk 1112 RPAVFTIGIVNGLC-GSSFLTRFRETLVHYSAI----------GSEQRLVLESDMLGSFALNIIACEGQDRTDRFESYK 1179
                                    **********9988.779*************97..........479********************************* PP

                          GRAS  314 kWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373 
                                    +W++r+++a ++++pl+ ++   +  ++++ + + + ++e++ +l++gWk+r L++ S W
  Zmw_sc03572.1.g00090.1.am.mk 1180 QWHMRMQRAELRQLPLDRDIIGAVTDMVKQQYHKDFVIHEDRRWLLQGWKGRILFAHSTW 1239
                                    *****************************999888************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.728205585IPR005202Transcription factor GRAS
PfamPF035148.4E-81233594IPR005202Transcription factor GRAS
PROSITE profilePS5098550.3648541220IPR005202Transcription factor GRAS
PfamPF035145.7E-858811239IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 1247 aa     Download sequence    Send to blast
MATTPEEFFV EGLVKPAPSS PSVFLDLPPT PDGNTDDPPS PGNILHLLWE DGIDDDLLYQ  60
CSDHHALLQA QQPFAQILSS PSSFVTNNDN RRGDTDTQGS KDPLQGGSGD LSSPFFKGAD  120
VVEAFLKGME EATRFLPGEY SIRSKAIKKR YSRDDYLEEE EEVRRTSKAT MMKIAEPEEV  180
DIVSEMMLRG DEACIEEMEK LRIAMDIEEG RKNKTRGKGV SKAAGDVVTD LPTLLLHCAE  240
AVAANNRTVA GELLKQIKHN ASATGDARQR LAQCFSKGLE ARLLGTGNQL WSLVAAERPS  300
VVELAKAYRL SMAACCFSKV AFIFSIKTIM DAAVGKSRVH VVDYGMNYGF HWAELICLMA  360
KDRDGARAEL KITAIGCSRR MFWSAQGIEE QGRRLRKCAS EFGLPFKFHS ITTTNWENVR  420
IQDLNADIGE VLIVNDMYNF MTLMDESMLF DEPSPRDIVL SNIRNMRPDV FIQSIVNSSN  480
GGSFLSRFRE ALFYYTALFD VFDATMPRQS ESRLVLEQEL LGNHLLNVVA CEGRDLMGRP  540
EKYRQCQARN QRAGLKQLPL KPGIVKGIKE FVKTHHKDFM LGEDGQWLLQ GWMASNGRLI  600
FEWILNRWAK EKLLNARNQV AAVTSSSTMA SAPKDQMGLD EPLPPSTSSI LLLPTFPMEQ  660
QQEQEHTPLE YISRMLMEEE EEEEDRVLLQ YHDDHPVLIQ AQQSLAQVNS SSSTSDNNAS  720
TTNPSFSKAL LNDERNSNLL FSSDGTILSR SAPSVVCSTD IENATARAAA AEHDWRHAAT  780
MSFLMGMAEA SKFLPRHSNL VFKTINTHDT GAEVSRASKL MAMTETEEAF LLQTTIDKMM  840
LNDCKLSRGE MEDLRAAMNN EAVARRQERR QRKRLLQVDL HALLLRCAET VMDDGHRGAR  900
ELLEKIKRHA SPTGDATQRL AHYFAEALET RLTGMGAHRS SFTIQQPVRF LKAYPLYIAT  960
CCFNKVAFMF CNRSIYQAAA GRSRLHIVDY GVCHGFQWPV LLRWLAAREG GPPQVTITGI  1020
VLTKHWYRPS DHIEETGHRL SNCARELGVP FKFQAIMAAK WDAVRLEDLN VDPDAALAVN  1080
SLFSLEMMDD DSVVVDRASP RDVVLGNIRR MRPAVFTIGI VNGLCGSSFL TRFRETLVHY  1140
SAIGSEQRLV LESDMLGSFA LNIIACEGQD RTDRFESYKQ WHMRMQRAEL RQLPLDRDII  1200
GAVTDMVKQQ YHKDFVIHED RRWLLQGWKG RILFAHSTWV ADDAYSP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-3223512398374GRAS family transcription factor containing p
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297