PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03532.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 180aa    MW: 19936.9 Da    PI: 10.1726
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03532.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.31.4e-075298450
                                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
                                  + + rr   NReA r++R+++ka  + Lee+vk+L a  ++L  +l+
  Zmw_sc03532.1.g00040.1.am.mk 52 SSKPRRPLGNREAVRKYREKRKAHAAFLEEEVKKLRATSQQLLRTLQ 98
                                  556788899*******************************9997765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.3E-114799No hitNo description
SMARTSM003381.1E-448113IPR004827Basic-leucine zipper domain
PfamPF077166.3E-1251106IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.88E-65298No hitNo description
CDDcd146861.94E-75699No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MPDSFADFLS SSQTHICNPP STSAAMHTHT CLHTHSQAIA GGGEDAAPRE ESSKPRRPLG  60
NREAVRKYRE KRKAHAAFLE EEVKKLRATS QQLLRTLQDH AALEAEARST PRSARPLFRC  120
SAVLAPSLWW VGMHQLCASM AILRSEEPGK RAIHRQPPIA GVMRVAACLE KLAFQRLCLP
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142351.11e-40uncharacterized protein LOC100274522
RefseqXP_020394445.11e-40putative bZIP transcription factor superfamily protein isoform X1
RefseqXP_020394446.11e-40putative bZIP transcription factor superfamily protein isoform X1
RefseqXP_020394447.11e-40putative bZIP transcription factor superfamily protein isoform X1
RefseqXP_020394448.11e-40putative bZIP transcription factor superfamily protein isoform X1
RefseqXP_020394449.11e-40putative bZIP transcription factor superfamily protein isoform X1
SwissprotQ8GTS22e-27BZP23_ARATH; Basic leucine zipper 23
TrEMBLB4G1L86e-41B4G1L8_MAIZE; Uncharacterized protein
STRINGGRMZM2G175870_P012e-40(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  3. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]