PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03532.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 180aa    MW: 19936.9 Da    PI: 10.1726
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03532.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.31.4e-075298450
                                  XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1  4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
                                  + + rr   NReA r++R+++ka  + Lee+vk+L a  ++L  +l+
  Zmw_sc03532.1.g00040.1.am.mk 52 SSKPRRPLGNREAVRKYREKRKAHAAFLEEEVKKLRATSQQLLRTLQ 98
                                  556788899*******************************9997765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.3E-114799No hitNo description
SMARTSM003381.1E-448113IPR004827Basic-leucine zipper domain
PfamPF077166.3E-1251106IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.88E-65298No hitNo description
CDDcd146861.94E-75699No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 180 aa     Download sequence    Send to blast
MPDSFADFLS SSQTHICNPP STSAAMHTHT CLHTHSQAIA GGGEDAAPRE ESSKPRRPLG  60
NREAVRKYRE KRKAHAAFLE EEVKKLRATS QQLLRTLQDH AALEAEARST PRSARPLFRC  120
SAVLAPSLWW VGMHQLCASM AILRSEEPGK RAIHRQPPIA GVMRVAACLE KLAFQRLCLP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142351.16e-41putative bZIP transcription factor superfamily protein
SwissprotQ8GTS22e-27BZP23_ARATH; Basic leucine zipper 23
TrEMBLB4G1L86e-41B4G1L8_MAIZE; Uncharacterized protein
STRINGGRMZM2G175870_P012e-40(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675