PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03526.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 256aa    MW: 29017.5 Da    PI: 10.6246
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03526.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF91.34.9e-2997147151
                                     S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                          SRF-TF   1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 
                                     krien + rqv+fskRrng+lKKA+ELSvLCdaeva+++fs++gklye++s
  Zmw_sc03526.1.g00070.1.sm.mkhc  97 KRIENPTSRQVSFSKRRNGLLKKAFELSVLCDAEVALVVFSTRGKLYEFAS 147
                                     79***********************************************86 PP

2K-box55.91.8e-191502123799
                           K-box  37 hllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                                     +llGe Le++s++eL++Le +Leksl+ +R +K++ll eq+++l++ke  l+++n++Lr+k +
  Zmw_sc03526.1.g00070.1.sm.mkhc 150 KLLGERLEECSIEELHSLEVKLEKSLRIVRGRKTQLLEEQVRKLKEKEMTLRKNNEDLREKCK 212
                                     79**********************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.1689149IPR002100Transcription factor, MADS-box
SMARTSM004321.5E-3789148IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-3091111IPR002100Transcription factor, MADS-box
CDDcd002657.94E-3591147No hitNo description
SuperFamilySSF554552.62E-2791149IPR002100Transcription factor, MADS-box
PfamPF003191.5E-2598145IPR002100Transcription factor, MADS-box
PROSITE profilePS512979.58100217IPR002487Transcription factor, K-box
PRINTSPR004042.7E-30111126IPR002100Transcription factor, MADS-box
PRINTSPR004042.7E-30126147IPR002100Transcription factor, MADS-box
PfamPF014863.8E-18150212IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MARALPEKRP MSCSHNLPRM GNSGLTYPFP FFIWVPMKHR QRATPTTNGS PPSSVSSSAW  60
LPPKLRHHPL SKPRQDSSIS LRTCDRSEMV RGKTQLKRIE NPTSRQVSFS KRRNGLLKKA  120
FELSVLCDAE VALVVFSTRG KLYEFASAGK LLGERLEECS IEELHSLEVK LEKSLRIVRG  180
RKTQLLEEQV RKLKEKEMTL RKNNEDLREK CKDQPLLVAP AAVDFTDVET ELYIGLPGRD  240
NRPNKAAIAV SQSNRA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3p57_J1e-1691148259Myocyte-specific enhancer factor 2A
3p57_I1e-1691148259Myocyte-specific enhancer factor 2A
3p57_D1e-1691148259Myocyte-specific enhancer factor 2A
3p57_C1e-1691148259Myocyte-specific enhancer factor 2A
3p57_B1e-1691148259Myocyte-specific enhancer factor 2A
3p57_A1e-1691148259Myocyte-specific enhancer factor 2A
3kov_J1e-1691148259Myocyte-specific enhancer factor 2A
3kov_I1e-1691148259Myocyte-specific enhancer factor 2A
3kov_B1e-1691148259Myocyte-specific enhancer factor 2A
3kov_A1e-1691148259Myocyte-specific enhancer factor 2A
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985920.17e-77PREDICTED: MADS-box transcription factor 50 isoform X2
RefseqXP_012698462.17e-77PREDICTED: MADS-box transcription factor 50 isoform X2
RefseqXP_004985919.17e-77PREDICTED: MADS-box transcription factor 50 isoform X2
SwissprotQ9XJ601e-73MAD50_ORYSJ; MADS-box transcription factor 50
TrEMBLQ9FR855e-75Q9FR85_MAIZE; M5 protein
STRINGGRMZM2G171365_P012e-74(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14133379