PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03511.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 236aa    MW: 27122.7 Da    PI: 8.6367
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03511.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM174.33.4e-5461331128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratk 79 
                                   lppGfrFhPtdeelv++yLk+kv+g ++el ++i+evd+yk+ePwdL  k  + ++++ewyfF +rd+ky++g r+nrat+
  Zmw_sc03511.1.g00060.1.am.mk   6 LPPGFRFHPTDEELVNYYLKRKVHGLSIEL-DIIPEVDLYKCEPWDLAeKsFLPGTDSEWYFFGPRDRKYPNGCRTNRATR 85 
                                   79****************************.99**************84334555788*********************** PP

                           NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   +gyWk+tgkd++v   +++ +g+kktLv+ykgrap+g +t+W+mheyr+
  Zmw_sc03511.1.g00060.1.am.mk  86 AGYWKSTGKDRRVSY-QNRSIGMKKTLVYYKGRAPQGLRTNWIMHEYRI 133
                                   **************9.8899***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-584142IPR003441NAC domain
PROSITE profilePS5100554.2196150IPR003441NAC domain
PfamPF023659.0E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MAPADLPPGF RFHPTDEELV NYYLKRKVHG LSIELDIIPE VDLYKCEPWD LAEKSFLPGT  60
DSEWYFFGPR DRKYPNGCRT NRATRAGYWK STGKDRRVSY QNRSIGMKKT LVYYKGRAPQ  120
GLRTNWIMHE YRIEESECDN TMGIQEVTAG VRTTAWTKNT SGRLDGRGIS HRSSASPHEQ  180
RHKCLAPSHV LDEMPEPEEG LEARCPHQCR NTPLAVTVGT SRYRYCNPAV ELKMPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-52213311140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008653036.11e-104NAC domain-containing protein 45
SwissprotQ9FFI52e-78NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A1D6IAU51e-102A0A1D6IAU5_MAIZE; NAC domain containing protein 57
TrEMBLA0A3L6E4371e-102A0A3L6E437_MAIZE; NAC domain-containing protein 86
STRINGSb02g032230.11e-103(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37133879
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]