PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03503.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 432aa    MW: 46336.9 Da    PI: 7.6254
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03503.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP69.56.7e-22182230149
                                   --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSE CS
                           SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrf 49 
                                   +Cq+egC+adls ak+yhrrhkvCe h+ka++v+  g+++rfCqqCsr+
  Zmw_sc03503.1.g00020.1.am.mk 182 RCQAEGCKADLSAAKHYHRRHKVCEYHAKAAAVADGGKQKRFCQQCSRY 230
                                   6***********************************************8 PP

2SBP41.73e-132492784877
                                   SEEETTT--SS--S-STTTT-------S-- CS
                           SBP  48 rfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                    fh l efDe+krsCr+rL +hn+rrrk++
  Zmw_sc03503.1.g00020.1.am.mk 249 EFHVLAEFDESKRSCRKRLTEHNRRRRKSA 278
                                   5***************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.8E-29176264IPR004333Transcription factor, SBP-box
PROSITE profilePS5114126.325180277IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.05E-27181278IPR004333Transcription factor, SBP-box
PfamPF031101.4E-16183230IPR004333Transcription factor, SBP-box
PfamPF031107.3E-7249276IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MSPATTDADF AFAPMQPNLG FDVAGNSHQD QHNLYDNFVD FAAGFPFQQD SSMSLLPPQT  60
SLPLLAPPPC LAMTAMPSLS PNHQMPLPGV QNAEICHPFN CSAGSPFLMK REDGPLVDAG  120
GGGGGRLGLN LGRRTYFSPA DVLAVDRLLM TRSSRFGVGM GMAGLLGLGL GAAHHHQPPP  180
PRCQAEGCKA DLSAAKHYHR RHKVCEYHAK AAAVADGGKQ KRFCQQCSRY VHPRLPRAEP  240
HTCPLLRYEF HVLAEFDESK RSCRKRLTEH NRRRRKSASA QGGEDSSPPP KKADTTSITT  300
SYSSDQKSAS TVAAKSTAIT PNGSGVSCLD MADNNGHQTS SAAAAAPTAL SLAAPPEKDS  360
GGLDAILMMH GSRVHRDDDE DQRFIPSLLL QAQQQQQHHN DGGHMLSCSS SMPDQHQNGG  420
GGRNGFFEVD FV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-221832761184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002451645.21e-127squamosa promoter-binding-like protein 5
SwissprotQ0E3F81e-55SPL5_ORYSJ; Squamosa promoter-binding-like protein 5
TrEMBLA0A1Z5RL611e-125A0A1Z5RL61_SORBI; Uncharacterized protein
STRINGSb04g005180.11e-126(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23753593