PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03462.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 235aa    MW: 25870.7 Da    PI: 4.5377
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03462.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM56.21.2e-17955148
                             NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                                    lppGf FhP+d el+++yLk+kv+g+++e  + i+evdiyk+ePwdLp
  Zmw_sc03462.1.g00060.1.am.mkhc  9 LPPGFGFHPSDAELISHYLKRKVHGQRIEY-DLIPEVDIYKHEPWDLP 55
                                    79***************************9.99**************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-27395IPR003441NAC domain
PROSITE profilePS5100515.4559166IPR003441NAC domain
PfamPF023651.3E-61052IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MEALRAMRLP PGFGFHPSDA ELISHYLKRK VHGQRIEYDL IPEVDIYKHE PWDLPCRPPS  60
GKRTEWIMHE YYIDENECRV SPDMKDAFVL CRVTRRDEWA LENDSGVGNR NPHPQNSNDT  120
AAFVPAEKQE DHATSVVIAK TQEAAGASVV IAKKQEDAAT SGNCAGEANH AGTPVSAELS  180
NDIVQTAFMG RFPNSDSELQ ALMEELADLS SKPAVDTDSA GLSLIGQDFE SSVCS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-157681373Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in stress response. {ECO:0000250|UniProtKB:Q7F2L3}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by salt and cold stresses. {ECO:0000269|PubMed:18813954}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021312344.14e-60NAC domain-containing protein 74
SwissprotQ7GCL78e-41NAC74_ORYSJ; NAC domain-containing protein 74
TrEMBLA0A1E5W8C02e-62A0A1E5W8C0_9POAL; NAC domain-containing protein 74
STRINGSb03g010130.11e-59(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75603847
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]