PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03449.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 465aa    MW: 50438.5 Da    PI: 8.3815
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03449.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS251.82.6e-77614512373
                          GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetsekn.sseelaal 81 
                                   +++++ c+ a++ g+   a+a+L+ +s  asp gd ++R+a+ f+eA a+r +r  ++l  a++ +  +     +   aa+
  Zmw_sc03449.1.g00010.1.am.mk  61 KHVIMYCVAALDMGNVMTASAALQSISSVASPLGDHLKRVAFTFAEAFARRAMRLLPGLTWAMQLQVPPLPMtPEAINAAR 141
                                   7899*******************************************************9999776665444155555677 PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetg 162
                                   + f  ++P+++++  + N+aIl a++ e++vH++D++  ++ QW+ L++ +a+R+++ppslR+ +v++    + + l++t+
  Zmw_sc03449.1.g00010.1.am.mk 142 RSFAALCPLVRVAATAVNHAILGAMAAERAVHVVDLGGANPNQWLELIRLFAARSRSPPSLRLSVVNE----EDDFLSSTA 218
                                   77******************************************************************....99******* PP

                          GRAS 163 erLakfAeelgvpfefnvl..vakrledleleeLrvkp.gEalaVnlvlqlhrll...........desvsleserdevLk 229
                                     L++ A +lgv+f fn++    ++++  ++++Lr+ + +Eal++ + lqlhrl            +e+  ++ + d++L+
  Zmw_sc03449.1.g00010.1.am.mk 219 GLLTQEAVRLGVNFLFNPVrsNIDHFTPTDVSALRIVEgREALVITSTLQLHRLIadevtinlpgvAENNMIT-KADALLR 298
                                   ******************7444445666689999999999***************666666666644444444.59***** PP

                          GRAS 230 lvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres...eerikvErellgreivnvvacegaerre 307
                                   ++++ +Pk+vv++eqea hn+e++  r+ +a++yy+alf  le++++  +    +r+ vEr+ll++e++++va  g  rre
  Zmw_sc03449.1.g00010.1.am.mk 299 VLRDQKPKLVVLTEQEAHHNDETLKCRVKNAFDYYAALFHDLETGAGGLAsgvADRVAVERVLLRNEVMDIVAGDGVLRRE 379
                                   ******************************************99855444455**************************** PP

                          GRAS 308 rhetlekWrerleeaGFkpvplsekaakqaklllrkvksdg.....yrve.eesgslvlgWkdrpLvsvSaW 373
                                   rhe+  +W  r++ aGF+p+p+++ + k+     +  ++ g     yr +  + g+++l+ ++ p++svS+W
  Zmw_sc03449.1.g00010.1.am.mk 380 RHEKITRWLTRMTVAGFEPIPMTYGVIKETAIAAHLLSGSGsnmriYRAQkVNTGCIFLYARKIPIFSVSVW 451
                                   ***********************99988866555555554422233666634588999************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.26634426IPR005202Transcription factor GRAS
PfamPF035149.1E-7561451IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MNPEGSNNNK GKAVVVKEEP SSLPMLVDAA SPAVPPPLPA APMANIPGPH QYGENRSLFI  60
KHVIMYCVAA LDMGNVMTAS AALQSISSVA SPLGDHLKRV AFTFAEAFAR RAMRLLPGLT  120
WAMQLQVPPL PMTPEAINAA RRSFAALCPL VRVAATAVNH AILGAMAAER AVHVVDLGGA  180
NPNQWLELIR LFAARSRSPP SLRLSVVNEE DDFLSSTAGL LTQEAVRLGV NFLFNPVRSN  240
IDHFTPTDVS ALRIVEGREA LVITSTLQLH RLIADEVTIN LPGVAENNMI TKADALLRVL  300
RDQKPKLVVL TEQEAHHNDE TLKCRVKNAF DYYAALFHDL ETGAGGLASG VADRVAVERV  360
LLRNEVMDIV AGDGVLRRER HEKITRWLTR MTVAGFEPIP MTYGVIKETA IAAHLLSGSG  420
SNMRIYRAQK VNTGCIFLYA RKIPIFSVSV WCPVMSGTEC ALTGI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-28604514374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002439698.11e-122hypothetical protein SORBIDRAFT_09g018540
TrEMBLK3ZDF11e-138K3ZDF1_SETIT; Uncharacterized protein
STRINGSi024587m1e-137(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137161330