PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03372.1.g00050.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 337aa    MW: 36871.7 Da    PI: 8.3293
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03372.1.g00050.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.76e-09118157443
                                   XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNk 43 
                                    kr +r   NR +A+rsR RK+++i eLe+ v +L+++++
  Zmw_sc03372.1.g00050.1.am.mk 118 PKRVKRILANRQSAQRSRVRKLQYISELERSVTTLQQQRR 157
                                   5999*******************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003380.0093115168IPR004827Basic-leucine zipper domain
PROSITE profilePS502178.829117158IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.6E-9119157No hitNo description
SuperFamilySSF579598.04E-9119158No hitNo description
PfamPF001704.2E-7119155IPR004827Basic-leucine zipper domain
CDDcd147034.14E-17120153No hitNo description
PROSITE patternPS000360122137IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MQCVASWLRL SSCSKSLVPC DPPISVAPAD GGAGEFDRLD DDQLMSMFPD EGGSASAPGS  60
ENGGSDSDGR DKRPAAAAVG AGKECDDERN GNVVAKEPVP GQDAAATVAA PTELIRDPKR  120
VKRILANRQS AQRSRVRKLQ YISELERSVT TLQQQRRERA PMCVRGVEPW RPAPFAWQPR  180
DATHLASSSP EVVVGSSSSR VPSPVHVRCL YPRMRCEREC ESEVSPWSGL RFTCPGRMLV  240
LFPATDTSNE VSVLSPRVAF LDQQRTILTV GNSHLKQRIA ALAQDKIFKD AHQEALKKEI  300
ERLRRVYEQQ NLKMSAGAPA SEHGPPPPVR AEKELMS
Functional Description ? help Back to Top
Source Description
UniProtTranscription regulator. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002456373.19e-52basic leucine zipper 6
SwissprotQ5JMK64e-45BZP06_ORYSJ; Basic leucine zipper 6
TrEMBLA0A0E0JNV16e-66A0A0E0JNV1_ORYPU; Uncharacterized protein
STRINGOPUNC01G30390.11e-66(Oryza punctata)
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]