PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03297.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 936aa    MW: 102317 Da    PI: 9.194
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03297.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.12.5e-511002291129
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPtdeel+ +yLkkk+  +k++l evi+evd++k+ePw+L++  ++ +  ++ewyfFs++d+ky+tg+r+nrat
  Zmw_sc03297.1.g00030.1.am.mk 100 VPPGFRFHPTDEELLLYYLKKKIGFEKFDL-EVIREVDLNKIEPWELQErcRIGSaPQNEWYFFSHKDRKYPTGSRTNRAT 179
                                   69****************************.99**************963433332566********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                   ++g+Wkatg+dk + + + +++g++ktLvfy+grap+g+ktdW+mhe+rle
  Zmw_sc03297.1.g00030.1.am.mk 180 TAGFWKATGRDKCIRT-SYRKIGMRKTLVFYRGRAPHGQKTDWIMHEFRLE 229
                                   ***************9.8999***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-5991251IPR003441NAC domain
PROSITE profilePS5100557.334100251IPR003441NAC domain
PfamPF023654.7E-26101228IPR003441NAC domain
Gene3DG3DSA:3.20.20.702.9E-138572930IPR013785Aldolase-type TIM barrel
SuperFamilySSF513956.64E-121572929No hitNo description
CDDcd029338.29E-174572911No hitNo description
PfamPF007242.0E-83573907IPR001155NADH:flavin oxidoreductase/NADH oxidase, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0010181Molecular FunctionFMN binding
GO:0016491Molecular Functionoxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 936 aa     Download sequence    Send to blast
MAARPSYHAL ALIAIKRSVN KVRVEASGSL TGRRIWQLTE LPARARMAVP CVLRDHLLSP  60
STAAAAGVNS SRPRPPPPPR SCGSRGKGVV MAVFSSSNGV PPGFRFHPTD EELLLYYLKK  120
KIGFEKFDLE VIREVDLNKI EPWELQERCR IGSAPQNEWY FFSHKDRKYP TGSRTNRATT  180
AGFWKATGRD KCIRTSYRKI GMRKTLVFYR GRAPHGQKTD WIMHEFRLEE ADDAQGGTSE  240
DGWVVCRVFK KKCFFKIGGG GEGSASQGAD AGGHLAASPP LGGHQSVLAS HYIHPHHQYY  300
HAASSYYSQM QVPAAYSHQV QVQDLLTNHR PTADAAGYDF SGLPVEHPAA AGGLDVGSSD  360
GVAADGAQME GRDQASGAAE QQWQAIDGFG NGAGNGAVQQ MTGAMSSGQR GGEMDLWGYG  420
SANEVRELVT RTEHPDAHSD GHGLWCSASE RPAGLVRRSR LRAFAIRRPR GTVTAHRHPI  480
HADTAQKKVG RMRGDPGDLW RCVVAERGQL GRLGSWLPRP KLHGCTFLRR REVERPCSVH  540
AVSVVGRSPK PRSRMGDDRH AVTGSEQTKA IPLLTPYKMG RFQLSHRVVL APLTRQRSFG  600
CVPQPHAAVY YAQRATQGGF LIAEATGVSH AAQGYPDTPG LWTREQVEAW KPVVDAVHAK  660
GGVFFCQIWH TGRASNYEFQ PNGQAPVSST DRQVAPKESA DGLSVTSYAV PRRLRTDEIP  720
AIVDDFRIAA QNAIEAGFDG VEVHAAHGYL IDQFLKDGVN DRTDEYGGSL ANRCRFALEV  780
VAAVAAEIGA DRVGVRVSPY TDYMDATDSD PDALGAHVAR ALGELGVLYL HAVEPRMLRP  840
TERGETRHSL RPMRDAFGGT FVVAGAYALE DGSRAVADGY ADLVAYGRLF LANPDLPRRF  900
ALDAPLNKYD RKTFYTPDPV IGYTDYPFLG GDDLSK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1vji_A0.0566929536812-oxophytodienoate reductase (OPR1)
2q3r_A0.0566929536812-oxophytodienoate reductase 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0D9W5F80.0A0A0D9W5F8_9ORYZ; Uncharacterized protein
STRINGLPERR04G10720.10.0(Leersia perrieri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP92973046