PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03297.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 118aa    MW: 13813.1 Da    PI: 10.4595
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03297.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF78.64.4e-251058250
                                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
                        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                                  rien   rqvtf+kRr g+lKKA ELS+LCda++ vi+fs++gk+ye +
  Zmw_sc03297.1.g00010.1.sm.mk 10 RIENPVHRQVTFCKRRMGMLKKARELSILCDADIGVIVFSPNGKIYELA 58
                                  8*********************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.058161IPR002100Transcription factor, MADS-box
SMARTSM004323.0E-35160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.92E-28178IPR002100Transcription factor, MADS-box
CDDcd002656.78E-35273No hitNo description
PRINTSPR004042.5E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003192.6E-241056IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048364Biological Processroot development
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGMLK KARELSILCD ADIGVIVFSP NGKIYELATN  60
GNMQGLIERY RSTYTQKRGE SSEQDKSQFR IQIMYKEIEM LRNKEGILKA SNDILQER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A3e-15170169MEF2 CHIMERA
6byy_B3e-15170169MEF2 CHIMERA
6byy_C3e-15170169MEF2 CHIMERA
6byy_D3e-15170169MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020194477.11e-55MADS-box transcription factor 26-like
RefseqXP_020194478.11e-55MADS-box transcription factor 26-like
SwissprotQ2QW552e-43MAD33_ORYSJ; MADS-box transcription factor 33
TrEMBLA0A0E0P9M72e-60A0A0E0P9M7_ORYRU; Uncharacterized protein
STRINGORUFI04G15040.13e-61(Oryza rufipogon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112