PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03251.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 676aa    MW: 74942.1 Da    PI: 5.7995
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03251.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM183.55.1e-5761331128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratk 79 
                                   lppGfrFhPtdeel+v+yLk+k++g+++el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk
  Zmw_sc03251.1.g00020.1.sm.mk   6 LPPGFRFHPTDEELIVYYLKRKINGRQIEL-EIIPEVDLYKCEPWDLPeKsFLPSKDLEWYFFSPRDRKYPNGSRTNRATK 85 
                                   79****************************.99**************95334455777*********************** PP

                           NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   sgyWkatgkd++v s ++++vg+kktLv+y+grap+g++tdWvmheyrl
  Zmw_sc03251.1.g00020.1.sm.mk  86 SGYWKATGKDRNVNS-HRRAVGMKKTLVYYRGRAPHGSRTDWVMHEYRL 133
                                   **************9.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-644156IPR003441NAC domain
PROSITE profilePS5100561.6376156IPR003441NAC domain
PfamPF023659.2E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 676 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELI VYYLKRKING RQIELEIIPE VDLYKCEPWD LPEKSFLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKSGYWK ATGKDRNVNS HRRAVGMKKT LVYYRGRAPH  120
GSRTDWVMHE YRLDERECET DTGLQDAYAL CRVFKKTAPG PKIIEHYGAV QHHIEQPQWT  180
ACNVDYRSPT LDLSCDVRGD DFESTSFSFP AEAPMDYTHG GFGMQMSASH EDGKWMQFLS  240
EDAFNATNPF FTNPASSSFS CIPSKVDVAL ECARLQHRLS LPPLEVEDFP HDVSLDTKTS  300
VLRSNPNEVD ILQQFLSVAS ASQELINGSS SSYAAEMWPG AGSRNVSTHY GNELSSLVEL  360
GVKAKVEADN FYHIEGCVGT SSSGFALKSG HVDEPVRLVE ISEMEEELKE EKKQVENLRG  420
VRLHNNDLGE IVVEGDESNP TECITQYPIT DTADNSGEAG HLTDPTDAGG GLDTAPIFSQ  480
SQPDDFAIGF DDVDNPSASF EPYEKVDVKH AGLFVSRVGA AKTFFHRVEP STKVSFHLSP  540
VASDVSKAIE KFHFPVNVTT KVSGRVSIFS KFKALIRDKF LMKPSYQRSI GSKEAAAGSE  600
LLNIVTLLLT PKEATGPAAE QELVMRKVMK PGSCSDGNSV WLPLSKGSKG ISSMFLSGKW  660
AFLTSALAIR SPGCNH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-56116212171NO APICAL MERISTEM PROTEIN
1ut4_B7e-56116212171NO APICAL MERISTEM PROTEIN
1ut7_A7e-56116212171NO APICAL MERISTEM PROTEIN
1ut7_B7e-56116212171NO APICAL MERISTEM PROTEIN
4dul_A7e-56116212171NAC domain-containing protein 19
4dul_B7e-56116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002468623.10.0uncharacterized protein LOC8085734
TrEMBLK4A6N60.0K4A6N6_SETIT; Uncharacterized protein
STRINGSi034541m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP66243651