PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03211.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 381aa    MW: 40955.2 Da    PI: 5.4174
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03211.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.73.7e-11182240563
                                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                     kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l +l+   + l+se+
  Zmw_sc03211.1.g00020.1.sm.mkhc 182 KRAKRILANRQSAARSKERKMRYIAELERKVQTLQTEATTLTTQLAMLQRDTSGLTSEN 240
                                     9************************************************9999999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.3E-17178242IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.151180243IPR004827Basic-leucine zipper domain
PfamPF001701.6E-9182240IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.9E-11182238No hitNo description
SuperFamilySSF579595.06E-11182233No hitNo description
CDDcd147031.31E-22183232No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MDETPTVDPA ASASTSTSAA GETAASRDVA AMLPNSPPRR GAGHRRAQSE ILLGGALPDD  60
LTFDADLGVV GEAGRDEYEE DDDEDEEECP GGSGAGSSSR MFEMFLENNG GLAEPTEPSP  120
HQHQQVSPAA PPARPRHQHS MSMDGSTSLG STSAGMAGRS GADAKKAISD AKLAELALVD  180
PKRAKRILAN RQSAARSKER KMRYIAELER KVQTLQTEAT TLTTQLAMLQ RDTSGLTSEN  240
SDLKMRVQSM EQQVRLQDAL NDRLRDEIQQ LKIATGQVNT NIGKMGNFGL SSYGGNLQSY  300
QRTQIQSLLA AQQLQQLQIH SQSQHQQQQT HLQQHLSTAQ QHQLLQEALP FPGDLKMKGL  360
ATTSLSQNAG ASDGHAVNSE P
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAPTransfer from AT1G06070Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353704.11e-164uncharacterized protein LOC100382174
SwissprotQ040882e-83POF21_ARATH; Probable transcription factor PosF21
TrEMBLC0PDU91e-163C0PDU9_MAIZE; BZIP transcription factor
STRINGGRMZM2G112483_P011e-163(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123022937
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]