PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03204.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 760aa    MW: 83705.6 Da    PI: 6.6404
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03204.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS356.25.1e-1093797501373
                          GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaal 81 
                                   l++lL++cA+av+++d + a++lL++++++asp+gd +qRla++f+e+L+arla+++s +y++l +++ts    +  l+a+
  Zmw_sc03204.1.g00020.1.am.mk 379 LRTLLIHCAQAVATDDRRSATELLKQIKQHASPQGDGTQRLAHCFAEGLQARLAGTGSMVYQSLMAKRTS---AVALLQAY 456
                                   6789************************************************************999998...899***** PP

                          GRAS  82 klfsevsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeelee 160
                                   +l+  +  + k++++  N +I +a  g++++Hi+D++i +G+QWp++l++++ R++gpp++ iTg++ p++g   +e++ee
  Zmw_sc03204.1.g00020.1.am.mk 457 QLYMAAICFKKVAFVFSNTTIFNASLGKKKIHIVDYGIHYGFQWPCFLKQISGREGGPPEVTITGIDLPQPGfrPTERIEE 537
                                   ***********************************************************************9********* PP

                          GRAS 161 tgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvv 241
                                   tg+rL+++A+e+gvpf++++++a+++e+++ e+L+++p+E+l+Vn+++q ++l+desv +es+rd vL+ +++++P+ +++
  Zmw_sc03204.1.g00020.1.am.mk 538 TGRRLSNYAREFGVPFKYHAIAASKMESVRKEDLNIDPDEVLIVNCMYQFKNLMDESVVIESPRDVVLNNIRKMQPHTFIH 618
                                   ********************************************************************************* PP

                          GRAS 242 veqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleea 322
                                   +  + + +++ F++rf eal yysalfd l+++ pr+s++r+ +E+ ++gr++ nv+aceg++r+er et+++W+ r ++a
  Zmw_sc03204.1.g00020.1.am.mk 619 AIVNGSFSAPFFVTRFREALFYYSALFDVLDTTTPRDSDQRMLIEQNIFGRSALNVIACEGTDRVERPETYKQWQVRNQRA 699
                                   ********************************************************************************* PP

                          GRAS 323 GFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
                                   G+k++pl+ ++++ ++  ++ ++ + + ++ ++++l++gWk+r L+++S W
  Zmw_sc03204.1.g00020.1.am.mk 700 GLKQLPLKRETVEIVRGKVKDCYHKDFVIDIDHHWLLQGWKGRILFAISTW 750
                                   ***********************889************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.698353731IPR005202Transcription factor GRAS
PfamPF035141.8E-106379750IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 760 aa     Download sequence    Send to blast
MQWKAGEKSP GPKPPLVGNG NAVECWRKVD GVERVMAWRC FCPPNGAELS RADPLPLQPA  60
SHQRRLEIPI SAAAFPEPSS ARLHSLPTRR LQIYPLSSLS LSSSRARPRP VTHAAAMGSS  120
YDLYQSPGAD DPSLYLFLSD LVPDSPSAYL DLPPTPHHEQ QQQPVSAAAA AADGGAAAGS  180
PEDLVLPYIS RMLMEDDIED KFFYDYPDNP SLLQAQQPFL EILSNSDDTT TTTTTTTTSS  240
GGGDHGDPSP TSSSSDGASA PAPSPAPPVA PAVTLSVKEE LFDAAPGNGV GRGRKNPYDH  300
DELEVEGGRS SKQSAVQGED DATRDMLDRV MMPSHEACVL QMQQLRIAMQ EEAAKNEAGG  360
KAGNGKAKGR RGGRDVVDLR TLLIHCAQAV ATDDRRSATE LLKQIKQHAS PQGDGTQRLA  420
HCFAEGLQAR LAGTGSMVYQ SLMAKRTSAV ALLQAYQLYM AAICFKKVAF VFSNTTIFNA  480
SLGKKKIHIV DYGIHYGFQW PCFLKQISGR EGGPPEVTIT GIDLPQPGFR PTERIEETGR  540
RLSNYAREFG VPFKYHAIAA SKMESVRKED LNIDPDEVLI VNCMYQFKNL MDESVVIESP  600
RDVVLNNIRK MQPHTFIHAI VNGSFSAPFF VTRFREALFY YSALFDVLDT TTPRDSDQRM  660
LIEQNIFGRS ALNVIACEGT DRVERPETYK QWQVRNQRAG LKQLPLKRET VEIVRGKVKD  720
CYHKDFVIDI DHHWLLQGWK GRILFAISTW VANDAGCPYF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-443837508374GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006664663.20.0PREDICTED: scarecrow-like protein 9, partial
RefseqXP_015620149.10.0PREDICTED: scarecrow-like protein 34
SwissprotO809331e-164SCL9_ARATH; Scarecrow-like protein 9
TrEMBLA0A0D3HVY80.0A0A0D3HVY8_9ORYZ; Uncharacterized protein
STRINGOB12G23410.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297