PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03143.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 545aa    MW: 59123.9 Da    PI: 7.4149
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03143.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.4e-521412691128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknrat 78 
                                   +ppGfrFhPt+eel+++yL+kkv++++++l +vi++vd++k+ePwd+++  k+ +  +++wyfFs++dkky+tg+r+nrat
  Zmw_sc03143.1.g00070.1.am.mk 141 VPPGFRFHPTEEELLNYYLRKKVASQEIDL-DVIRDVDLNKLEPWDIQEecKIGSgPQNDWYFFSHKDKKYPTGTRTNRAT 220
                                   69****************************.9***************953444443456********************** PP

                           NAM  79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   ++g+Wkatg+dk++++   + +g++ktLvfykgrap+g+k+dW+mheyrl
  Zmw_sc03143.1.g00070.1.am.mk 221 AAGFWKATGRDKAIYN-AVKRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 269
                                   ****************.8899***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-55135279IPR003441NAC domain
PROSITE profilePS5100554.831141329IPR003441NAC domain
PfamPF023657.2E-28142269IPR003441NAC domain
SuperFamilySSF1019412.48E-55317329IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 545 aa     Download sequence    Send to blast
MSHDDVTSQD AAGSRWLSSE ICRSLAARPM LPRRRRDVGP RPPREIDRNA SRDHSQIDST  60
AKDSNQPPLY KDAPFLSCGL RPVCSSSSSG PLSSSPACCC SCTHQLELNP KNTLNKKRWQ  120
TQRLREKERS MSISVNGQSC VPPGFRFHPT EEELLNYYLR KKVASQEIDL DVIRDVDLNK  180
LEPWDIQEEC KIGSGPQNDW YFFSHKDKKY PTGTRTNRAT AAGFWKATGR DKAIYNAVKR  240
IGMRKTLVFY KGRAPHGQKS DWIMHEYRLD DPATDAAAAA TVKLQPSFSL QSIHLHRSTT  300
PPIGPVTAAA ASSDAGQEDG WVVCRVFKKK YHVKESGSGG GGKHGPRHGG GDHGQGSKAA  360
AMHGQGLQYS SSDETLDQIL TYMVRSCKQE HEVLSPQSVG GGAGRPGSRC LGPIETVLGG  420
HRFMKLPPLE SPSAATALPH VPGETAAASS GGGDDDLHRG GNGITDWAMM DRLVASHLNG  480
QPDPDVPAED QLCSFDDGGD EGDGAMDGLA FYSAAATRLL SGGDDDLWNF ARSAATSTST  540
ERLID
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A7e-431272695140Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1123128LREKER
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020164672.11e-169NAC domain-containing protein 43-like
SwissprotQ84WP61e-110NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A3B6RGI31e-171A0A3B6RGI3_WHEAT; Uncharacterized protein
TrEMBLA0A446XJ681e-171A0A446XJ68_TRITD; Uncharacterized protein
STRINGPavir.J20698.1.p1e-169(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]