PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03129.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family VOZ
Protein Properties Length: 509aa    MW: 57133.6 Da    PI: 4.9313
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03129.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ2435.7e-7530342793217
                             VOZ  93 aelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlye 171
                                     +elfdl ++ege+irewlffdkprraf+sgnrkqrslpdy grgwhesrkqvmk+fgglkrsyymdpqpsss+ewhlye
  Zmw_sc03129.1.g00010.1.sm.mkhc 303 PELFDLYIFEGESIREWLFFDKPRRAFDSGNRKQRSLPDYGGRGWHESRKQVMKDFGGLKRSYYMDPQPSSSYEWHLYE 381
                                     8****************************************************************************** PP

                             VOZ 172 yeineldalalyrlelklvdekksakgkvskdsladlqkklgrlta 217
                                     yein++da+alyrle+k++d+kksak+k++++sl+++q++++rl+a
  Zmw_sc03129.1.g00010.1.sm.mkhc 382 YEINDCDAFALYRLEFKSSDAKKSAKSKLACNSLNEIQQQMVRLSA 427
                                     ********************************************97 PP

Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0009414Biological Processresponse to water deprivation
GO:0009631Biological Processcold acclimation
GO:0009816Biological Processdefense response to bacterium, incompatible interaction
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048578Biological Processpositive regulation of long-day photoperiodism, flowering
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MGKGPSSRAG SRHQQFRARA KTRVDDLQEM FSGLQSARKD SRSADAAVLE EQLHQMLREW  60
RAELSAPSPA SSLQGNNRER SDPPSESLRM LQLAAAKEEE EDDATSKLVD QQQPLPPPPA  120
PANQGQGHVQ AGPDMKMEPN EEAVPVAQQH PPLGQGVLVN GGIFPAPTAA AAVFHDQMYY  180
VNQELTVEDF LYDDDYKINL TGSNPDVLSN LEGIGQLEYP QFNLPQELPP NMYLDMNNCG  240
QTAGNAFLHM SDLLTTMTPA PAAFLRPKCA LWDCPRPAIG SERWQDYCSM YHGDLAVKEE  300
GPPELFDLYI FEGESIREWL FFDKPRRAFD SGNRKQRSLP DYGGRGWHES RKQVMKDFGG  360
LKRSYYMDPQ PSSSYEWHLY EYEINDCDAF ALYRLEFKSS DAKKSAKSKL ACNSLNEIQQ  420
QMVRLSADGP VNAKRPSRSR IKSNPKDVNA NIYSVPNSTT QVNVPNAYQA VPQVDQMQFL  480
NGDVVYGPHL PYGYSTERSD FYWNSNDGA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012702007.10.0transcription factor VOZ1 isoform X1
TrEMBLA0A3L6SN530.0A0A3L6SN53_PANMI; Transcription factor VOZ1
STRINGSi000864m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23433888