PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03121.1.g00070.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 656aa    MW: 70909.2 Da    PI: 9.4875
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                             NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                      e+++w+fF++rd+ky+tg r+nrat++gyWk+tgkd+++++ ++++ g+kktLvf++gr p+g++t+W+mhey + 205 IEDNKWHFFASRDRKYPTGGRSNRATRAGYWKSTGKDRAIKQ-NKRTLGTKKTLVFHEGRPPSGKRTEWIMHEYYI 279
                                     4789*************************************9.999****************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100533.406143302IPR003441NAC domain
PfamPF023654.5E-14204278IPR003441NAC domain
SuperFamilySSF1019417.19E-34205301IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 656 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-2420730270165NO APICAL MERISTEM PROTEIN
1ut4_B6e-2420730270165NO APICAL MERISTEM PROTEIN
1ut7_A6e-2420730270165NO APICAL MERISTEM PROTEIN
1ut7_B6e-2420730270165NO APICAL MERISTEM PROTEIN
3swm_A5e-2420730273168NAC domain-containing protein 19
3swm_B5e-2420730273168NAC domain-containing protein 19
3swm_C5e-2420730273168NAC domain-containing protein 19
3swm_D5e-2420730273168NAC domain-containing protein 19
3swp_A5e-2420730273168NAC domain-containing protein 19
3swp_B5e-2420730273168NAC domain-containing protein 19
3swp_C5e-2420730273168NAC domain-containing protein 19
3swp_D5e-2420730273168NAC domain-containing protein 19
4dul_A6e-2420730270165NAC domain-containing protein 19
4dul_B6e-2420730270165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008673881.11e-131NAC domain-containing protein 74
TrEMBLA0A060CZ481e-130A0A060CZ48_MAIZE; NAC domain-containing protein 89 (Fragment)
STRINGGRMZM2G064541_P011e-131(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number