PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03102.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 129aa    MW: 15038.2 Da    PI: 9.6909
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03102.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.55.4e-311059251
                                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                    rienk  rqvtfskRrng+lKKA+E+SvLCdaeva+i+fs +gklyeyss
  Zmw_sc03102.1.g00070.1.sm.mkhc 10 RIENKVHRQVTFSKRRNGLLKKAHEISVLCDAEVALIVFSAKGKLYEYSS 59
                                    8***********************************************96 PP

2K-box14.81.2e-06861126793
                           K-box  67 skKnellleqieelqkkekelqeenka 93 
                                     + +n+l++++i elqkkek+l ++n +
  Zmw_sc03102.1.g00070.1.sm.mkhc  86 ADQNQLMFDSIFELQKKEKMLIDQNGY 112
                                     679******************999976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.3E-38160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.651161IPR002100Transcription factor, MADS-box
CDDcd002653.03E-42274No hitNo description
SuperFamilySSF554552.75E-32279IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-31323IPR002100Transcription factor, MADS-box
PfamPF003192.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004047.0E-313859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MGRGPVQLRR IENKVHRQVT FSKRRNGLLK KAHEISVLCD AEVALIVFSA KGKLYEYSSH  60
ASMEGILERY HRYSFEERAA LDPTVADQNQ LMFDSIFELQ KKEKMLIDQN GYVNLVEHTN  120
LNRNHVLHK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_S4e-21174173Myocyte-specific enhancer factor 2B
1tqe_R4e-21174173Myocyte-specific enhancer factor 2B
1tqe_Q4e-21174173Myocyte-specific enhancer factor 2B
1tqe_P4e-21174173Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002460989.14e-54hypothetical protein SORBIDRAFT_02g038780
SwissprotA2YNI24e-53MAD18_ORYSI; MADS-box transcription factor 18
SwissprotQ0D4T44e-53MAD18_ORYSJ; MADS-box transcription factor 18
TrEMBLC5XDW74e-54C5XDW7_SORBI; Putative uncharacterized protein Sb02g038780
STRINGSb02g038780.11e-53(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398