PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03080.1.g00120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family G2-like
Protein Properties Length: 536aa    MW: 55809.7 Da    PI: 8.5311
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03080.1.g00120.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.51.5e-28249298251
                       G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                                   pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Zmw_sc03080.1.g00120.1.am.mk 249 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 298
                                   9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.12E-13246299IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-25247298IPR009057Homeodomain-like
TIGRFAMsTIGR015577.1E-21249299IPR006447Myb domain, plants
PfamPF002491.9E-5250298IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 536 aa     Download sequence    Send to blast
MEASSAASPD LSLHISLPST GPSGGRAVAG GAGGGAGGDP WRRLNGSTAS TELSLSPPAE  60
PDADALPWRH RPSAVASSSA ATTSSALMHV PMLQPLDDGG GAAGGGVDVS AAPPIRGIPI  120
YNGPGGFPFL PPVPGGDGHQ KVGFYGSYHH PATWPSSLGS TMPSPLAPGA SSFDPASVFL  180
SPAAHHHHRM LSASGRFNGM LTDTLRGYGA GGMGGIGGHH HHHLHGAQPF GLGSRFMPKF  240
PAKRSMRAPR MRWTSTLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQLL  300
PFLLLFGSDK NANAVTPELV NDGETDGWGL AAKKLPLLWG ERERERKLAY VCARTAQSSR  360
TMAREREGKG IAATGGREGP RRGHGIMVFP SVHFLVFLAL IHLLVIRLLV SSLREVVKLI  420
AAFLGMYRTV KSTDKPAASS GPADGGSGDD EFSGASQAAS GGDNMCVRPF GEHRSTSEGA  480
ASSVGGCGGD MDQSSAGNTN IRWGNSSSSQ VSNHELSSPS LEFTLGRPDW QGADHD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A5e-14250298351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B5e-14250298351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C5e-14250298351Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D5e-14250298351Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates abaxial identity during leaf development. {ECO:0000269|PubMed:18594992}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001353566.11e-117uncharacterized protein LOC100280930 isoform 1
SwissprotQ0J2356e-84ROLL9_ORYSJ; Probable transcription factor RL9
TrEMBLA0A1D6I3X21e-116A0A1D6I3X2_MAIZE; Milkweed pod1
TrEMBLB5LZ601e-116B5LZ60_MAIZE; Milkweed pod1
STRINGGRMZM2G082264_P011e-117(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25583787