PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02932.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MIKC_MADS
Protein Properties Length: 248aa    MW: 27834.5 Da    PI: 6.5839
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02932.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF885.1e-28959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien++nrqvtfskRr g+lKKA+EL vLCda+v v+ifsstgk++ey+s
  Zmw_sc02932.1.g00130.1.sm.mk  9 KRIENSTNRQVTFSKRRGGLLKKANELAVLCDARVGVVIFSSTGKMFEYCS 59
                                  79***********************************************96 PP

2K-box59.51.4e-2071163192
                         K-box   1 yqkssgks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieel 80 
                                   yq++++++  e ++ ++   e++++k+e+++L+  +R++ G+dL+sL+l + + LeqqLe s++k+R++K+++l +q + l
  Zmw_sc02932.1.g00130.1.sm.mk  71 YQHTTNNHfEEINHDQQIFVEMTRMKEEVDKLEMGIRRYAGDDLSSLTLSDVNDLEQQLEFSVNKVRTRKEHILEDQNSML 151
                                   66667777777788899999************************************************************* PP

                         K-box  81 qkkekelqeenk 92 
                                    ++ +e+q++n 
  Zmw_sc02932.1.g00130.1.sm.mk 152 CRMINENQQQNL 163
                                   ***999999985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.282161IPR002100Transcription factor, MADS-box
CDDcd002651.63E-44278No hitNo description
SuperFamilySSF554554.32E-33289IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-29323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004042.6E-293859IPR002100Transcription factor, MADS-box
PfamPF014862.3E-1781162IPR002487Transcription factor, K-box
PROSITE profilePS5129711.27985178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0019252Biological Processstarch biosynthetic process
GO:0043068Biological Processpositive regulation of programmed cell death
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MGRGKIEIKR IENSTNRQVT FSKRRGGLLK KANELAVLCD ARVGVVIFSS TGKMFEYCSP  60
TCSLKELIEQ YQHTTNNHFE EINHDQQIFV EMTRMKEEVD KLEMGIRRYA GDDLSSLTLS  120
DVNDLEQQLE FSVNKVRTRK EHILEDQNSM LCRMINENQQ QNLAVGRGDM KLAAEMSPLA  180
MLPPPAVAFG HDAAAYYGGE SSSSSTALQL MSAAPQLHHP GGGEGFRLQP TQPNLQDLHH  240
GHHGLQLW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P8e-18185183Myocyte-specific enhancer factor 2B
1tqe_Q8e-18185183Myocyte-specific enhancer factor 2B
1tqe_R8e-18185183Myocyte-specific enhancer factor 2B
1tqe_S8e-18185183Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001105130.11e-131MADS-box protein ZMM17
SwissprotQ8VWM81e-133M17_MAIZE; MADS-box protein ZMM17
TrEMBLB4FPJ31e-131B4FPJ3_MAIZE; Uncharacterized protein
TrEMBLB6TVD91e-131B6TVD9_MAIZE; MADS-box transcription factor 29
STRINGSb04g004736.11e-130(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP185037100