PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02908.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 171aa    MW: 19919.1 Da    PI: 6.8932
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02908.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.62.7e-1381140463
                                   XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                                    +r rr+++NRe+ArrsR RK++++ eL   v  L + N++L ++l++    ++++  e+
  Zmw_sc02908.1.g00030.1.am.mk  81 ERRRRRMISNRESARRSRMRKQKQLSELWAQVVHLRSTNRQLLDQLNHVIRDCERVLHEN 140
                                   6899*********************************************99999988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-1478142IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.6E-1078135No hitNo description
PfamPF001703.4E-1080140IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.70380143IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.39E-1282132No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
CDDcd147028.68E-1587127No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MNMYPAEIAS IPYLSPSSAA SFNPHYHVST DDFLFQYNNM LAPHPTSYQD VAQLVHEASF  60
PVGNKSNSDE SDDYQRSLAE ERRRRRMISN RESARRSRMR KQKQLSELWA QVVHLRSTNR  120
QLLDQLNHVI RDCERVLHEN SQLRDEQTKL QKQLEKLPEV TTEASDMGTD S
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
181102RRRRRMISNRESARRSRMRKQK
294101RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00647PBMTransfer from LOC_Os02g49560Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002454348.11e-105basic leucine zipper 43
TrEMBLA0A3L6RPG11e-104A0A3L6RPG1_PANMI; Basic leucine zipper 43
STRINGSb04g029210.11e-104(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP118635126