PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02906.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 460aa    MW: 49638.9 Da    PI: 8.5574
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02906.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM49.21.8e-151161152
                           NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvk 52
                                  lppGfrFhPtdeel+++yL++kv++  + +  ++ e+d++k+ePw+Lp++++
  Zmw_sc02906.1.g00060.1.am.mk 11 LPPGFRFHPTDEELITHYLARKVADPCFAA-LAVGEADLNKSEPWELPSELD 61
                                  79***********************99888.67**************96554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-16660IPR003441NAC domain
PROSITE profilePS5100516.33811189IPR003441NAC domain
PfamPF023656.0E-81254IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MEQELHQPME LPPGFRFHPT DEELITHYLA RKVADPCFAA LAVGEADLNK SEPWELPSEL  60
DSDASSLATP ALELVGFDPG PDETSYSLPA CLSRQCRATR RRRSPTGLID GGSSARGAGA  120
SRVAVSWNRS FLDGAGSRKG EPIDQRWLAR AIDDSNGARR ANGAGPPAPS QASGSFKNSG  180
IAFCLVCPYL PDIFASGIQL AAADCLRTGA GHELRFDMVT IRKLTAFDPE RKWKGEVCTS  240
KPPSSPAVGP GDETPAVYVQ RFVRSLVALE RQRVPVAIVS SLSLVCLQQL LMRTTSFTTP  300
WPESTGGHAG AGSSPYLHRR QISGTKPERE PLRRPATAGS TCMDKLTRES LPAPVRPLVD  360
LGLLLPLTTD AASTNDTTRN NESEDGALTR SKRSPRATCA PGRARKKARR DDDDHAYYVP  420
LAARAARGSP VLPFRGSNHR PRDDVSHPFP PAREEPQAAV