PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02904.1.g00120.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 140aa    MW: 15135.1 Da    PI: 8.4138
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02904.1.g00120.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP79.45.3e-2561112253
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 
                                   CqvegC  dl+ akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsr+  l 
  Zmw_sc02904.1.g00120.1.am.mk  61 CQVEGCGLDLTGAKEYHRKHRVCEAHTKCPRVVVAGHERRFCQQCSRWVWLP 112
                                   ***********************************************97765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-2454108IPR004333Transcription factor, SBP-box
PROSITE profilePS5114119.13658135IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.8E-2459113IPR004333Transcription factor, SBP-box
PfamPF031106.7E-1961108IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 140 aa     Download sequence    Send to blast
MEWTVPKPAA SPSSQPLLWD WGDSATPASG SSGEAPARRG GREREGKRAK GEDGGAGEVK  60
CQVEGCGLDL TGAKEYHRKH RVCEAHTKCP RVVVAGHERR FCQQCSRWVW LPDLLLSISR  120
MSSAVDLVDC RAASSRASCA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A6e-1559114459squamosa promoter-binding protein-like 12
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004951747.14e-58squamosa promoter-binding-like protein 4
SwissprotQ6H5091e-32SPL4_ORYSJ; Squamosa promoter-binding-like protein 4
TrEMBLA0A1E5WDC12e-59A0A1E5WDC1_9POAL; Squamosa promoter-binding-like protein 11
STRINGPavir.J20730.1.p2e-58(Panicum virgatum)
STRINGSi017749m2e-57(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]