PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02904.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 313aa    MW: 33146.7 Da    PI: 5.1898
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02904.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1537.2e-17137188455
                                     XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                                     +kr rr+ +NRe+ArrsR+RK+a ++eLe+ v++L +eN +L k+l   +++
  Zmw_sc02904.1.g00060.1.sm.mkhc 137 VKRMRRMVSNRESARRSRKRKQAHLAELETQVDQLRGENASLFKQLTDANNQ 188
                                     79****************************************9877666555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.7E-18134198IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.243136188IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-13137189No hitNo description
PfamPF001701.5E-14137188IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1707.6E-14138189No hitNo description
CDDcd147021.04E-22139189No hitNo description
PROSITE patternPS000360141156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MKKCPSELEL EAFIGGGVDG DAEQKPGHVS QFDAGVMFQA GGGDLSAFSF ADSNTLNGTI  60
PSHLWSHNHG GARHPAISTT IESQSSICAA ASPISATNLN VKESQTLGGT SGSDSDSDSL  120
FDTEGGPCEQ STNPLDVKRM RRMVSNRESA RRSRKRKQAH LAELETQVDQ LRGENASLFK  180
QLTDANNQFT TAVTDNRILK SDVEALRLKV KLAEDMVARG AVSCGLGHMS LSPVLNPRQA  240
CRGPDVLAGL DFPGDDAYLT GLSPTEQVQN SPLQSIASLE SIDNRMASEV TSCGGAGVDV  300
RGWDSHFNGG LSK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1150156RRSRKRK
2150157RRSRKRKQ
3152157SRKRKQ
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that possesses broad binding specificity for DNA promoter elements with the core sequence 5'-ACGT-3'. May be involved in the regulation of genes expressed during seed development (PubMed:7919992). Binds to the DNA specific sequence 5'-TGAGTCA-3' found in seed storage protein gene promoters (PubMed:11133985). {ECO:0000269|PubMed:11133985, ECO:0000269|PubMed:7919992}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021315644.11e-179basic leucine zipper 9-like isoform X1
SwissprotQ6ETX01e-135RSBZ3_ORYSJ; bZIP transcription factor RISBZ3
TrEMBLA0A194YMZ41e-178A0A194YMZ4_SORBI; Uncharacterized protein
STRINGSb04g005020.11e-178(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20953796
Publications ? help Back to Top
  1. Onodera Y,Suzuki A,Wu CY,Washida H,Takaiwa F
    A rice functional transcriptional activator, RISBZ1, responsible for endosperm-specific expression of storage protein genes through GCN4 motif.
    J. Biol. Chem., 2001. 276(17): p. 14139-52
    [PMID:11133985]
  2. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  3. Izawa T,Foster R,Nakajima M,Shimamoto K,Chua NH
    The rice bZIP transcriptional activator RITA-1 is highly expressed during seed development.
    Plant Cell, 1994. 6(9): p. 1277-87
    [PMID:7919992]