PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02884.1.g00130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 462aa    MW: 49173.5 Da    PI: 6.8621
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02884.1.g00130.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_144.24.2e-14323374557
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                   +r+rr++kNRe+A rsR+RK+a++ eLe +   L++eN++L+ e e ++k+ +
  Zmw_sc02884.1.g00130.1.am.mk 323 RRQRRMIKNRESAARSRARKQAYTVELEAELNHLKEENERLRAE-ELMEKMLE 374
                                   79****************************************44.33444444 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.3E-13319381IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.243321366IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.2E-13323380No hitNo description
SuperFamilySSF579591.5E-10323366No hitNo description
PfamPF001703.9E-11323374IPR004827Basic-leucine zipper domain
CDDcd147071.77E-23323364No hitNo description
PROSITE patternPS000360326341IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MASETSKNVK ALDEQEVTSH QRDQSFRVAS RAAAAAEEPA ADPLARQSSI LSLTLEELQN  60
SLCEPGRNFG SMNMDEFVAN VWNAEEFQAA TGGGKEDHED EATLATGTSE GGGAGGGSGL  120
CRQGSFSLPP PLSRKTVEEV WAEISQGPPG AQPHAAPPQA VVQPQMGSGG VAVSGGQATL  180
GEMTLEDFLV KAGVVRGSLA GHGQAPAAVG MVPTGPLTHM QQGQLAAPMM FQVAPPGNAV  240
YPVMGDGMGY HNGYPGGMTA VPPPPPSQCV VAEVSPGSSD GMSAMTQAEM VNFPGNGGMV  300
MNGGNTRKRE SPEDECTEKT VERRQRRMIK NRESAARSRA RKQAYTVELE AELNHLKEEN  360
ERLRAEELME KMLEQSRENV SAKKQSGRGM RRCGSCMCGL VTLVFLTTDP SSFPRTIPRR  420
RFGDLRLRSA ASKSRVCEAR VTLRFAATRG IGKKVPPLFG IY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1105117TGTSEGGGAGGGS
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that possesses transactivation activity in yeast (PubMed:17604002, PubMed:21055780, PubMed:18236009). Involved in abscisic acid (ABA) signaling pathway. Binds to the G-box motif 5'-CACGTG-3' of TRAB1 gene promoter (PubMed:17604002). Involved in the regulation of pollen maturation. May act as negative regulator of salt stress response (PubMed:18236009). Together with PYL5, PP2C30 and SAPK2, is part of an ABA signaling unit that modulates seed germination and early seedling growth (PubMed:22071266). {ECO:0000269|PubMed:17604002, ECO:0000269|PubMed:18236009, ECO:0000269|PubMed:21055780, ECO:0000269|PubMed:22071266}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by abscisic acid (ABA) (PubMed:21055780, PubMed:18236009, PubMed:22071266). Induced by salt stress. Down-regulated by cold and drought stresses (PubMed:18236009). {ECO:0000269|PubMed:18236009, ECO:0000269|PubMed:21055780, ECO:0000269|PubMed:22071266}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001296980.10.0protein ABSCISIC ACID-INSENSITIVE 5
SwissprotQ8RZ351e-155ABI5_ORYSJ; bZIP transcription factor ABI5 homolog
TrEMBLK3XIK90.0K3XIK9_SETIT; Uncharacterized protein
STRINGSi001731m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38303558
Publications ? help Back to Top
  1. Zou M,Guan Y,Ren H,Zhang F,Chen F
    A bZIP transcription factor, OsABI5, is involved in rice fertility and stress tolerance.
    Plant Mol. Biol., 2008. 66(6): p. 675-83
    [PMID:18236009]
  2. Kim H, et al.
    A rice orthologue of the ABA receptor, OsPYL/RCAR5, is a positive regulator of the ABA signal transduction pathway in seed germination and early seedling growth.
    J. Exp. Bot., 2012. 63(2): p. 1013-24
    [PMID:22071266]
  3. Bhatnagar N, et al.
    The protein phosphatase 2C clade A protein OsPP2C51 positively regulates seed germination by directly inactivating OsbZIP10.
    Plant Mol. Biol., 2017. 93(4-5): p. 389-401
    [PMID:28000033]