PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02883.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 357aa    MW: 39309.3 Da    PI: 6.3232
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02883.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.58.6e-56161431129
                             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratk 79 
                                     lppGfrFhPtdee+v++yL++k+ ++ ++   +i evd++k+ePwdLp  +k +ekewyfF+++d+ky+tg+r+nrat+
  Zmw_sc02883.1.g00080.1.sm.mkhc  16 LPPGFRFHPTDEEIVTHYLTPKALDRFFTS-GIIGEVDLNKCEPWDLPGLAKMGEKEWYFFCHKDRKYPTGTRTNRATE 93 
                                     79************************9988.89***************8888899************************ PP

                             NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                                     sgyWkatgkdke+++ +g lvg+kktLvfy+grap+gekt+Wvmhe+rle
  Zmw_sc02883.1.g00080.1.sm.mkhc  94 SGYWKATGKDKEIFRGRGVLVGMKKTLVFYRGRAPRGEKTEWVMHEFRLE 143
                                     ***********************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-638166IPR003441NAC domain
PROSITE profilePS5100558.52216166IPR003441NAC domain
PfamPF023655.0E-2917142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0000975Molecular Functionregulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MSEVSVINQT AGQLELPPGF RFHPTDEEIV THYLTPKALD RFFTSGIIGE VDLNKCEPWD  60
LPGLAKMGEK EWYFFCHKDR KYPTGTRTNR ATESGYWKAT GKDKEIFRGR GVLVGMKKTL  120
VFYRGRAPRG EKTEWVMHEF RLEGKLPQPL PRSAKDEWAV CKVVNKELLA AKPGASIVTA  180
GAEIERVGSL GFISDLLDSA AELPPLMDPT FGADVDEVID FKGLASTSTS GHGAAPGGVS  240
YLPVKTEEQY LHHHQQPQST PMFYTGSSPY FSLPEVNSGD IQTAIRRYCK AELVASGQTT  300
SVVSPSRETG LSTDPNAAAG YAEISSAATP SSSHHHHHPF LQELDDPVLN LADIWKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-521317214171NO APICAL MERISTEM PROTEIN
1ut4_B9e-521317214171NO APICAL MERISTEM PROTEIN
1ut7_A9e-521317214171NO APICAL MERISTEM PROTEIN
1ut7_B9e-521317214171NO APICAL MERISTEM PROTEIN
3swm_A1e-511317217174NAC domain-containing protein 19
3swm_B1e-511317217174NAC domain-containing protein 19
3swm_C1e-511317217174NAC domain-containing protein 19
3swm_D1e-511317217174NAC domain-containing protein 19
3swp_A1e-511317217174NAC domain-containing protein 19
3swp_B1e-511317217174NAC domain-containing protein 19
3swp_C1e-511317217174NAC domain-containing protein 19
3swp_D1e-511317217174NAC domain-containing protein 19
4dul_A9e-521317214171NAC domain-containing protein 19
4dul_B9e-521317214171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that acts as positive regulator of leaf senescence. Activates NYC1, SGR1, SGR2 and PAO, which are genes involved in chlorophyll catabolic processes. Activates senescence-associated genes, such as RNS1, SAG12 and SAG13. {ECO:0000269|PubMed:27021284}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00332DAPTransfer from AT3G04060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004984514.10.0NAC domain-containing protein 79
SwissprotQ9SQQ62e-90NAC46_ARATH; NAC domain-containing protein 46
TrEMBLA0A368SRF40.0A0A368SRF4_SETIT; Uncharacterized protein
STRINGPavir.Ib01526.1.p0.0(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Oda-Yamamizo C, et al.
    Corrigendum: The NAC transcription factor ANAC046 is a positive regulator of chlorophyll degradation and senescence in Arabidopsis leaves.
    Sci Rep, 2016. 6: p. 35125
    [PMID:27759025]
  4. O'Shea C, et al.
    Structures and Short Linear Motif of Disordered Transcription Factor Regions Provide Clues to the Interactome of the Cellular Hub Protein Radical-induced Cell Death1.
    J. Biol. Chem., 2017. 292(2): p. 512-527
    [PMID:27881680]