PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02883.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 729aa    MW: 79830.2 Da    PI: 9.9104
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02883.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM164.63.4e-511913181128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeel+ +yL++++ + ++++  +i++vdiyk++Pw Lp++++ ++kewyfFs+rd+ky++g r+nra+ sg
  Zmw_sc02883.1.g00030.1.am.mk 191 LPPGFRFHPTDEELILHYLRNRAGSLPCPE-AIIADVDIYKFDPWALPSMAAYGDKEWYFFSPRDRKYPNGIRPNRAAGSG 270
                                   79*************************999.88***************8777899************************** PP

                           NAM  82 yWkatgkdkevlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatg+dk+++s+ + e+vg+kk Lvfy gr pkg+kt+W+mheyrl
  Zmw_sc02883.1.g00030.1.am.mk 271 YWKATGTDKAIHSTtTFENVGVKKALVFYMGRPPKGTKTNWIMHEYRL 318
                                   ************9866678***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-63183351IPR003441NAC domain
PROSITE profilePS5100560.305191351IPR003441NAC domain
PfamPF023651.5E-26192318IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 729 aa     Download sequence    Send to blast
MLLVCLQAAA IPLSDGILSR EKKICRGRRK PWPGRSPRKA ARWKHRPPTR AGAAEFQRQP  60
SWGPPSPRIS GGITPDVREA RRNDDQTITT HAPACRCRSP APPHYRERPG AWAPREARSP  120
PVPEKNPPFP HFSELDRAEL LSPSSRGLAA RALRGEEGRS ITTSAPARSV DRSRAWERLV  180
PMVMANPATS LPPGFRFHPT DEELILHYLR NRAGSLPCPE AIIADVDIYK FDPWALPSMA  240
AYGDKEWYFF SPRDRKYPNG IRPNRAAGSG YWKATGTDKA IHSTTTFENV GVKKALVFYM  300
GRPPKGTKTN WIMHEYRLAA DANGGHAYRP MKFGNASMRL DDWVLCRIYN KTSHASPTPV  360
PSFPNHEQDE PCGFDEALYT TSSSAGMNIL QGGVAASAFP MQQAATGGTQ MMPRIQSFSE  420
LLNEYSLAQF FDDGGVQHAV PHLDQQHHAP LLGHPVASHL LVNNGNSNMS GQLLLANSTA  480
STSAAAAGDG SMVGGKRKRT EESWSHHQAA AAKKPNSSCI GATGVYAEPP WNCEEQCSSY  540
EDRYPGHIPC SVYLPVSRLG SQAGRRVRSA HAGATVVVLH GVLELVQHDA AWPPGGRSHA  600
CIRTRKQGSR SASHHQLLQE IRPNYESNQL VQQEAGREIV RTSERGEVGE AREVALAWPA  660
CIVRCRTGCQ PRPHPAAMGN VRYVPRGTDR GAASDRARAC VARVLRALPD GVPAVAYAFS  720
AVERKIQST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-6619035516169NO APICAL MERISTEM PROTEIN
1ut4_B1e-6619035516169NO APICAL MERISTEM PROTEIN
1ut7_A1e-6619035516169NO APICAL MERISTEM PROTEIN
1ut7_B1e-6619035516169NO APICAL MERISTEM PROTEIN
3swm_A1e-6619035519172NAC domain-containing protein 19
3swm_B1e-6619035519172NAC domain-containing protein 19
3swm_C1e-6619035519172NAC domain-containing protein 19
3swm_D1e-6619035519172NAC domain-containing protein 19
3swp_A1e-6619035519172NAC domain-containing protein 19
3swp_B1e-6619035519172NAC domain-containing protein 19
3swp_C1e-6619035519172NAC domain-containing protein 19
3swp_D1e-6619035519172NAC domain-containing protein 19
4dul_A1e-6619035516169NAC domain-containing protein 19
4dul_B1e-6619035516169NAC domain-containing protein 19
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP123736123