PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02867.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 438aa    MW: 47226.9 Da    PI: 10.4163
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02867.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.42.8e-21286329245
                                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
                        SRF-TF   2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 
                                   + en+s rq+t+skRr gilKKA+ELS+LCd++  +++fs+tgk
  Zmw_sc02867.1.g00040.1.am.mk 286 KLENSSGRQITYSKRRSGILKKAKELSILCDIDLILLMFSPTGK 329
                                   679***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.474277329IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-21277336IPR002100Transcription factor, MADS-box
SMARTSM004323.8E-29277336IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-17279299IPR002100Transcription factor, MADS-box
PfamPF003199.2E-19287330IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-17299314IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-17314335IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 438 aa     Download sequence    Send to blast
LASVSSCPGR WTVAGSAPLT GQARKRSGRD EQRRAFGGGG GALAGLPDVS RVPGTTQQGH  60
TDYQQAPSAT QVAFESAGAA CRERSFLVTL ILMHNSGSRS IWLPALCAAV LYAGTYDVEG  120
DVWNRYVSQR RHGSVLCHGA ARLRLVTLWH HLPSEPFSFP PARFSLYLLS ARLFLSPRPR  180
LSRPKNSAGF AGTWPDLPHP PSLPPSLALS PLLPSGSRSA PLNRSTDGKL VGAFRVSVVA  240
RSPALAPRRV CVSSPPETGS SVGRGNRTPS VWLFSAMGRV KLKIKKLENS SGRQITYSKR  300
RSGILKKAKE LSILCDIDLI LLMFSPTGKP TICIGDKRDI GCSTGTSLQS YPGYFSMSKH  360
STDTGGGSEH GQPSLQQTPP PDFSHADCLT SLHLGAQFPY TPFDHTSLLN ERMFRPDVVE  420
LHDGVVYPGP SQHQQVMI
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659