PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02857.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 284aa    MW: 30589.7 Da    PI: 6.2629
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02857.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.57e-09131177450
                                   XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                                   + + rr   NReA r++R++ ka  + Lee+vk+L a N++L  +l+
  Zmw_sc02857.1.g00140.1.sm.mk 131 SSKPRRPLGNREAVRKYREKGKAHAAFLEEEVKKLRATNQQLLRTLQ 177
                                   556788899*********************************97775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.5E-14126196No hitNo description
SMARTSM003381.2E-6127195IPR004827Basic-leucine zipper domain
PfamPF077161.1E-12130185IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.06E-6134178No hitNo description
CDDcd146862.01E-8135185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MLVAGLDRGI LLGIGKVLEL FAEGKKEFRL SETGYAEVMR RRAENTFGIR VIYLKQLGQI  60
WVVGWEFELH KFPVEAPVTW QSSVDQFLFG GDRAPKHICN PPSTSAAVTC LHTHSQAIAG  120
GGEDAAPREE SSKPRRPLGN REAVRKYREK GKAHAAFLEE EVKKLRATNQ QLLRTLQDHA  180
ALEAEAVRLR SLLLDVRGKI DAEVGASPFP MQCSVGSVSV VGGDASALCF NGNSEVGGAW  240
EESYTPAAAD RGSDEGGGMS REIGISEVVP SMNVAAGAEF VTPG
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025805852.11e-70basic leucine zipper 23-like isoform X4
SwissprotQ8GTS23e-33BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0A9S3G72e-73A0A0A9S3G7_ARUDO; Uncharacterized protein
STRINGGRMZM2G175870_P013e-67(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  3. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]