PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02857.1.g00140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 284aa    MW: 30589.7 Da    PI: 6.2629
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02857.1.g00140.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.57e-09131177450
                                   XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50 
                                   + + rr   NReA r++R++ ka  + Lee+vk+L a N++L  +l+
  Zmw_sc02857.1.g00140.1.sm.mk 131 SSKPRRPLGNREAVRKYREKGKAHAAFLEEEVKKLRATNQQLLRTLQ 177
                                   556788899*********************************97775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1705.5E-14126196No hitNo description
SMARTSM003381.2E-6127195IPR004827Basic-leucine zipper domain
PfamPF077161.1E-12130185IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.06E-6134178No hitNo description
CDDcd146862.01E-8135185No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MLVAGLDRGI LLGIGKVLEL FAEGKKEFRL SETGYAEVMR RRAENTFGIR VIYLKQLGQI  60
WVVGWEFELH KFPVEAPVTW QSSVDQFLFG GDRAPKHICN PPSTSAAVTC LHTHSQAIAG  120
GGEDAAPREE SSKPRRPLGN REAVRKYREK GKAHAAFLEE EVKKLRATNQ QLLRTLQDHA  180
ALEAEAVRLR SLLLDVRGKI DAEVGASPFP MQCSVGSVSV VGGDASALCF NGNSEVGGAW  240
EESYTPAAAD RGSDEGGGMS REIGISEVVP SMNVAAGAEF VTPG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142351.13e-68putative bZIP transcription factor superfamily protein
SwissprotQ8GTS22e-34BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A0A9S3G74e-75A0A0A9S3G7_ARUDO; Uncharacterized protein
STRINGGRMZM2G175870_P011e-67(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38313675