PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02850.1.g00150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 304aa    MW: 33179.4 Da    PI: 4.479
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02850.1.g00150.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_135.12.9e-11145195555
                                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                                     ++ rr ++NR +A +sR+RKk +++eLe+k+k Leae ++L   l+ +  e
  Zmw_sc02850.1.g00150.1.sm.mkhc 145 RKKRRQMRNRDSAMKSRERKKIYVKELETKSKYLEAECRRLSYALQCYAAE 195
                                     6899**********************************9999877766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.8E-5140205IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.852143206IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.8E-12145204No hitNo description
PfamPF001703.0E-9145201IPR004827Basic-leucine zipper domain
SuperFamilySSF579594.63E-11145203No hitNo description
CDDcd147048.51E-15146197No hitNo description
PROSITE patternPS000360148163IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010200Biological Processresponse to chitin
GO:0030968Biological Processendoplasmic reticulum unfolded protein response
GO:0005634Cellular Componentnucleus
GO:0005789Cellular Componentendoplasmic reticulum membrane
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MDADFFADID FAALLASFSD EPAAVSDLIV PSPPPSSPPP ARDGESGSPE SVTSRSGPPA  60
EEALSEIERF LMTEGDAEAA GALEGVSVEE FFDALYDGGE AEREEEKEKK ESEAGASTDE  120
GSGKEEEVVT ADAEKEVDGD DLVSRKKRRQ MRNRDSAMKS RERKKIYVKE LETKSKYLEA  180
ECRRLSYALQ CYAAENMVLR QSLLKDRPGV APTAMQESAV LTETLPMVSL LWLVSIVCLF  240
LMPGLPSPSP AAPRRSGRDP AMVARKTSCE NPDTLDLILH GRRCKGTRAK IKLDTFPFHA  300
VDAC
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in endoplasmic reticulum (ER) stress response (PubMed:21223397, PubMed:22050533, PubMed:22199238). Acts downstream of the ER stress sensors IRE1, BZIP39 and BZIP60 to activate BiP chaperone genes (PubMed:22050533, PubMed:22199238). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533, ECO:0000269|PubMed:22199238}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00019PBMTransfer from AT1G42990Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By dithiothreitol-induced endoplasmic reticulum (ER) stress response (PubMed:22050533, PubMed:21223397). Induced by salt stress (PubMed:22050533). {ECO:0000269|PubMed:21223397, ECO:0000269|PubMed:22050533}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965858.11e-147bZIP transcription factor 50
SwissprotQ69XV01e-100BZP50_ORYSJ; bZIP transcription factor 50
TrEMBLA0A0C5KQY61e-155A0A0C5KQY6_ELECO; BZIP transcription factor
STRINGSi006978m1e-147(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69343750
Publications ? help Back to Top
  1. Wakasa Y, et al.
    Expression of ER quality control-related genes in response to changes in BiP1 levels in developing rice endosperm.
    Plant J., 2011. 65(5): p. 675-89
    [PMID:21223397]
  2. Lu SJ, et al.
    Conservation of IRE1-regulated bZIP74 mRNA unconventional splicing in rice (Oryza sativa L.) involved in ER stress responses.
    Mol Plant, 2012. 5(2): p. 504-14
    [PMID:22199238]