PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02791.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 314aa    MW: 34297.9 Da    PI: 8.7366
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02791.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.93.9e-53121371128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeel+++yL++kv+++++ +  ++ e+d++k+ePw+Lp+ +k +ekewyfF+ +d+ky+tg r+nrat +g
  Zmw_sc02791.1.g00030.1.am.mk  12 LPPGFRFHPTDEELITHYLARKVADSRFAA-LAVGEADLNKSEPWELPSLAKMGEKEWYFFCLKDRKYPTGLRTNRATVAG 91 
                                   79*************************999.67***************8888899************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWkatgkdk++++ +++lvg kktLvfy+grapkgek+ Wvmheyrl
  Zmw_sc02791.1.g00030.1.am.mk  92 YWKATGKDKDIFR-GKALVGSKKTLVFYTGRAPKGEKSGWVMHEYRL 137
                                   *************.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.75E-626162IPR003441NAC domain
PROSITE profilePS5100557.7312162IPR003441NAC domain
PfamPF023651.5E-2813137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MKQDLHQQPM ELPPGFRFHP TDEELITHYL ARKVADSRFA ALAVGEADLN KSEPWELPSL  60
AKMGEKEWYF FCLKDRKYPT GLRTNRATVA GYWKATGKDK DIFRGKALVG SKKTLVFYTG  120
RAPKGEKSGW VMHEYRLHGK LVNGVPKVGS KNEWVLCRVY KKSLAGLVSP PAAAKKGTGE  180
MARTDDMVLA HLPRLMDMSG GATVNPAATH VTCFSDELKG QFFNHAVPQT TATANNGTDH  240
LGLASSPFFA QYGQGVSLVQ LLESNGYDVG LAADAGMPQG LSASQDTGLT SDVNPETSSS  300
SGQKFDHQDQ LWGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A4e-541016218168NAC domain-containing protein 19
3swm_B4e-541016218168NAC domain-containing protein 19
3swm_C4e-541016218168NAC domain-containing protein 19
3swm_D4e-541016218168NAC domain-containing protein 19
3swp_A4e-541016218168NAC domain-containing protein 19
3swp_B4e-541016218168NAC domain-containing protein 19
3swp_C4e-541016218168NAC domain-containing protein 19
3swp_D4e-541016218168NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975858.11e-153NAC domain-containing protein 92 isoform X1
RefseqXP_025826317.11e-153NAC domain-containing protein 92-like
RefseqXP_025826319.11e-153NAC domain-containing protein 92-like
RefseqXP_025826320.11e-153NAC domain-containing protein 92-like
RefseqXP_025826321.11e-153NAC domain-containing protein 92-like
SwissprotQ9FLJ22e-90NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A3G1VCF20.0A0A3G1VCF2_9POAL; NAC domain transcription factor
STRINGSi010553m1e-152(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27303787
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]