PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02789.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family LBD
Protein Properties Length: 246aa    MW: 25597.5 Da    PI: 8.9694
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02789.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.42.9e-44281271100
                        DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 
                                   +CaaCk+lrrkC ++Cv+apyfp e+p+kfanvhk+FGasn++kll++l +++reda+ssl+yeAear++dPvyG+vg i+
  Zmw_sc02789.1.g00020.1.am.mk  28 PCAACKFLRRKCLTGCVFAPYFPPEEPQKFANVHKVFGASNITKLLNELLPHQREDAVSSLAYEAEARVKDPVYGCVGAIS 108
                                   7******************************************************************************** PP

                        DUF260  82 klqqqleqlkaelallkee 100
                                    lq+q+++l++el+++++e
  Zmw_sc02789.1.g00020.1.am.mk 109 MLQRQVHRLQKELDAAHAE 127
                                   **************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.33327128IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4328125IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MALPPSTSNS AVSPVAAPGS TTPGAGAPCA ACKFLRRKCL TGCVFAPYFP PEEPQKFANV  60
HKVFGASNIT KLLNELLPHQ REDAVSSLAY EAEARVKDPV YGCVGAISML QRQVHRLQKE  120
LDAAHAELLR YACGDIGIPT ALPVSAAPRF SATMPSTGQL AAATAGGGMY SGRRLSAIDG  180
ISPPPSSAGC YFMRNNVMID AGRAGATYVH NSVHAAAIRR DSKGPIALGM GLVCPSVVAP  240
HPLCSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-81211474131LOB family transfactor Ramosa2.1
5ly0_B1e-81211474131LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_025818403.11e-117protein LATERAL ORGAN BOUNDARIES-like
RefseqXP_025818404.11e-117protein LATERAL ORGAN BOUNDARIES-like
SwissprotQ9FML48e-65LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A0A9DMU91e-117A0A0A9DMU9_ARUDO; Uncharacterized protein
STRINGPavir.J38993.1.p1e-114(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP88133545
Publications ? help Back to Top
  1. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  2. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]