PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02762.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 1173aa    MW: 129887 Da    PI: 11.5722
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02762.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_127.95.1e-0910321089562
                                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1    5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklkse 62  
                                    kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  ++ l ++
  Zmw_sc02762.1.g00030.1.am.mk 1032 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSSGLATQ 1089
                                    899******************************************9999888777666 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-1610281092IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.71410301093IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1706.3E-1010321089No hitNo description
PfamPF001701.5E-810321090IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.79E-1010321082No hitNo description
CDDcd147032.66E-2110331082No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1173 aa     Download sequence    Send to blast
MIKTDAAYFN RRVIEQRKVL QHLARVLQHL ARHGGQLVSF DCSTGRPPFE PVHHAAQRAR  60
WRQPRDCTVH ACLAASSRYT PYGESAVQRS GAAVAPAGRG RRRIHVSSAS MWACPPPRAP  120
ANPSATRWRI PDVGARQPPR HPAGARRPHR APTTVAGRQP VHSPPEHVDE FTLLALARGY  180
IVGNVPVSAT GRPRQASDRV DPSLGAQRRV ISSKSVWKKK KKILGVSGKK VEGFPVRRWR  240
ADSPTIICRR ARRTRLSRLE TGQSLPAETT WLSSRPRARA RLPDRARSMR PWTNNLPNDH  300
APFRSLPTPR FRIVDRRASS TRTCSAIAAQ SSRLVEMDPY DMACIIDGAP CPQRRRSIAH  360
RPERSSSGVV PIRFGRRARA EGQHAMWFAS MATAERRERQ APRRDSLIDR SESPSRGHVG  420
VPAPVRRVVV LDFMTTADLT VRRAYVAGSV ERPFLFLRAE SRMAYGGGRS SLRTPAGSGI  480
DLAVRRPRLD PWQRLPPPFA AAFVRCAVSH PIVRGDDVSR TRSGNLKVCL RCTQFGHGRR  540
ACRARKLSTR TPVRGAALLR PMGERVNKLE YYAPFVLKEV AYVFNWLPLH CSSSSKNQSV  600
ASKTRGLHTV SQRRFQSSLF QPQYYTPHLP FRHPLVSCRF GSLRPSLSSP AYGPPAQVAR  660
TTYSHSLPVQ FQTGSERTPR DVNGDDSHPT CSSRTPCGPV PGREPRVLES GFLTVSNRSA  720
LHFTISLSRS PIDRRAFRKR DDSAAAAARE VFLRVKTGAA PPADHEGERS ANSASATWEL  780
GSPVAVRDPQ QGLLMAKLSN DRSIVDDQDE HFRCKKQRHL ISAVRSMQRD RPNGTTFPRA  840
SRPKMMRRLP ARGGAHRRSR SDVPFGYFQP PSPKTEASGG GWGLPVSGGG GDDLFNAYMS  900
MDGVDAGLRY GSDGDSLGSS MRTNGADSSE NESEDYGGGA DSQFLVWGDA AGKKSREGGK  960
RNGAREPAAA PAGRGHARSL SMDSLIGKLS FSANGEPSKF SLDFGGGEFT PAEMKRIMAD  1020
EKLAEMALAD PKRVKRVLAN RQSAARSKER RMRYIAELEQ KVQILQTEAT TLSAQLTLLQ  1080
RDSSGLATQN NELKFRLQAM EQQAQLRDAL NEALTAEVQR LKVGDASSSS NLPQQMQLHC  1140
QSQMQELHKQ QQGEQIPFYQ LEQREVARNH EAK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1217229KKKKKILGVSGKK
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576