PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02730.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 1275aa    MW: 138074 Da    PI: 10.8997
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02730.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP128.62.3e-40507583278
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                   C v+gC+adls+++eyhrrhkvCe+hsk+pvv+v+g+e rfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+
  Zmw_sc02730.1.g00020.1.am.mk 507 CAVDGCDADLSKCREYHRRHKVCEAHSKTPVVVVAGREMRFCQQCSRFHSLVEFDEAKRSCRKRLDGHNRRRRKPQP 583
                                   **************************************************************************987 PP

2SRF-TF93.31.1e-2912141264151
                                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF    1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51  
                                    k+ienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+iifs++gkl+e++s
  Zmw_sc02730.1.g00020.1.am.mk 1214 KQIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIIFSNRGKLFEFCS 1264
                                    68***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-34499568IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.129504581IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-37505586IPR004333Transcription factor, SBP-box
PfamPF031101.8E-30507580IPR004333Transcription factor, SBP-box
SMARTSM004327.0E-3912061265IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.21212061266IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.16E-2712071266IPR002100Transcription factor, MADS-box
CDDcd002654.73E-3612071264No hitNo description
PROSITE patternPS00350012081262IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-3012081228IPR002100Transcription factor, MADS-box
PfamPF003191.2E-2412161262IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-3012281243IPR002100Transcription factor, MADS-box
PRINTSPR004045.8E-3012431264IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1275 aa     Download sequence    Send to blast
MRPEATGRGW LSARQGKSER SFVSRRPRQA KQITTDTAIT EEAAAQQYAG VGPSKKEALQ  60
QNYQPVSVEI HVNNPGRRSR PRRARFPSDG KLATAPNRRC RAHCFGKSAK PLSLAATPHT  120
RTGPGRKPRP SDGDARRSLR EIQGTEKTTT RGAAATHSVA VRQRRRRNVT LACAWDNRRH  180
TILLGERNWR VRHKPPPLQQ TAGVFFSKGM GRKTRRSYRN HAPVSPVLAR SSLISGADCR  240
AHATTPSFVV HRPPIDGHHK GEQELPELAR CSARAHQRRA FQRKSDVDGR DAVVLVQRGQ  300
IRAVRDRNCV GCVCIKHKGS MPLLKGEHGP GAPLGPSPLE SLQPSTSRKL CICCASSISL  360
ASSLSLRALC SAQGTLVSLG GLMDWDLKMP VSWDLAELEH DAVPAISAPT APVAAATSGI  420
ATAAAAARGT PTRAECSVDL KLGGLGDFGA AEVTKEPKPP AKGPAVTVSS PPAASAVVPS  480
ASPLKRXXLK RPRTGPGGAN GPQCPSCAVD GCDADLSKCR EYHRRHKVCE AHSKTPVVVV  540
AGREMRFCQQ CSRFHSLVEF DEAKRSCRKR LDGHNRRRRK PQPDDMNARS FMTSQQGPRL  600
SSFVTPRPEP SCSYSAHQVL CNRPHFAGST STYSKEGRRF PFLQDGDQLS FGTGGAASLE  660
AATACQSLLK TVAAPESSSS NKIFSPDRLT SVLDSDCALS LLSSSANSSS VDVSRMVQPT  720
EHIPMAQPLV PSMQQFGSSP SWFSQAASSG VVVSTAGFTC PSMDSEQLNP VLVPSSDGHE  780
MNYHGIFHVG GEGSYDGTSS SLPFSWHFDR RLLSSMAEFL FARPTLHSYH PCWIRNASVF  840
ARSRRTAGRG WAVGWYRLSA RQDDSHANLS APIASRGRAG GRQGTKFCLA RPGARRGRAD  900
KASEHGKMSV LGVQASKVEW HVTSGCAEQP PRATGRPPDL GIVDRHVVKL MTGSCRVRAP  960
YDVAPHLAIP PPTARVRARY PADAAGGPSN RWFRTADDGV RVHNLGLAPL AEGWREVSVL  1020
YSLVPLMTTE KPSRLTLTGE QLRPVCSNCG NQSLASSRAE PERQPRRPVA GLEEAGNDAA  1080
HGKRKGGVAQ KYDSTRGRVD VRADHETGLG FRPLGFRVAH HLTRNGKERS APITPPPSRP  1140
AFTTPRRPAI STQRTSPALT SSVPHSSPPS LPLCVCCFAW REACLLLTSV GSRLAATPAR  1200
EEARAMGRGR VELKQIENKI NRQVTFAKRR NGLLKKAYEL SVLCDAEVAL IIFSNRGKLF  1260
EFCSGQRDVA SRESS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-27495580184squamosa promoter binding protein-like 4
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1563580KRSCRKRLDGHNRRRRKP
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP17553795