PlantTFDB
Plant Transcription Factor Database
PlantRegMap/PlantTFDB v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02702.1.g00020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 705aa    MW: 76856.8 Da    PI: 10.2061
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02702.1.g00020.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC71.69e-23350393144
                           WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                   d+epgrCrRtDGKkWRCs+++++++k+CE+H hrg++rsrk++e
  Zmw_sc02702.1.g00020.1.am.mk 350 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHKHRGKNRSRKPVE 393
                                   79***************************************998 PP

2QLQ60.64.4e-21279314237
                           QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                   +FTa+Q+q+L++Q+l+yK+La+++P+P++L+ ++++
  Zmw_sc02702.1.g00020.1.am.mk 279 PFTATQWQELEHQALIYKCLASGMPIPSHLVPPLRR 314
                                   9******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.6E-11278314IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.8E-15279312IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.663279314IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.744350394IPR014977WRC domain
PfamPF088792.0E-18351393IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 705 aa     Download sequence    Send to blast
MSFRSESQSQ QQQTQKRTAA MPADFKDGPK SQKMSRTPDN RRFKFWAGGG LHTVRVQALV  60
GGCRPSAWST DAGPNGARFW VARCRVHVAL CFARAAPDGP IEWRQQGAKQ PERAGARQQG  120
ASCQRGRELG ACAPKLRGQE QIANVEQKFP TLVRCASIAT VERRPNGSDK LQAAALKSLR  180
RRPHLELTRT RPRPTTKPAH LVTLAITLAA TPPLHRSTKK PASRPRGAPG TYSCGAGSVV  240
LFIGSRSGKG SSCATQVTAK MMMMTNREGG AGAAAGRYPF TATQWQELEH QALIYKCLAS  300
GMPIPSHLVP PLRRILDSAL ATSPSLGFPP QPSLGWGCYG MAFGRKAHED PEPGRCRRTD  360
GKKWRCSKEA YPDSKYCEKH KHRGKNRSRK PVEMSLATAA PSASAASATT ATSSPAPSYH  420
RPAPEAAPYT ALYGGSPYAA STRPVTGAYH AAQVSPFHIH LDTTYPHPPA SSYYSVNQRD  480
YAYGHTAKDV GEHAFFSDGA TERDRHAAGQ WQFRQLGMEP KPSATSLFPN GGCNNGTASA  540
YAVDMTTKDD DEERRRQQQH CFVLGADLRL ERPSNHDVPE AQKPLRPFFD EWPHEKSNKG  600
SWMGLGGETQ LSMAIPVAAN DLPVTSRYRT LLFQDLAAEP RPCSLESYWQ QGFKACTCCL  660
PGTVTVSRSD GRKYRSECHR HLLMAASKAQ ASLSRSCATG GSTEV
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954097.10.0growth-regulating factor 1 isoform X1
RefseqXP_012701613.10.0growth-regulating factor 1 isoform X2
SwissprotQ6AWY81e-158GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLK3YTB60.0K3YTB6_SETIT; Uncharacterized protein
TrEMBLK3YTC00.0K3YTC0_SETIT; Uncharacterized protein
STRINGSi017515m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP57413652