PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02702.1.g00020.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRF
Protein Properties Length: 705aa    MW: 76856.8 Da    PI: 10.2061
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                           WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                                   d+epgrCrRtDGKkWRCs+++++++k+CE+H hrg++rsrk++e 350 DPEPGRCRRTDGKKWRCSKEAYPDSKYCEKHKHRGKNRSRKPVE 393
                                   79***************************************998 PP

                           QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                                   +FTa+Q+q+L++Q+l+yK+La+++P+P++L+ ++++ 279 PFTATQWQELEHQALIYKCLASGMPIPSHLVPPLRR 314
                                   9******************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.6E-11278314IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.8E-15279312IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.663279314IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166723.744350394IPR014977WRC domain
PfamPF088792.0E-18351393IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 705 aa     Download sequence    Send to blast
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a regulatory role in gibberellin-induced stem elongation. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004954097.10.0growth-regulating factor 1 isoform X1
RefseqXP_012701613.10.0growth-regulating factor 1 isoform X2
SwissprotQ6AWY81e-158GRF1_ORYSJ; Growth-regulating factor 1
TrEMBLK3YTB60.0K3YTB6_SETIT; Uncharacterized protein
TrEMBLK3YTC00.0K3YTC0_SETIT; Uncharacterized protein
STRINGSi017515m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number