PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02690.1.g00070.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 275aa    MW: 29748.6 Da    PI: 10.4511
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02690.1.g00070.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM76.37.4e-2446963128
                             NAM  63 krdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                     +rd+ky++g+r+nr+t sgyWkatg d+ v +++++ +glkktLvfy g+apkg +++W+m+eyrl
  Zmw_sc02690.1.g00070.1.sm.mkhc   4 SRDRKYRNGDRPNRVTPSGYWKATGADRMVRVEGNRSIGLKKTLVFYVGKAPKGLRSSWIMNEYRL 69 
                                     689*************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100532.56189IPR003441NAC domain
SuperFamilySSF1019411.22E-28389IPR003441NAC domain
PfamPF023652.5E-91269IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
MGSSRDRKYR NGDRPNRVTP SGYWKATGAD RMVRVEGNRS IGLKKTLVFY VGKAPKGLRS  60
SWIMNEYRLP HGEADRYQKE ISLCRVYKRP GIEDNFHLTG MTARSSGSKA AATMDKKHRT  120
SASPRLAPMF DGGHSSGLMN KPYSGTNNGL TPSSVAAAAP AAVLQTSMFR STAGSAASLS  180
SATSTEEDGT SLYHLKGANP MLPSSTHALL NANSTTMATI PIDELSRAVG SYNNNGNPNQ  240
QPLPFQGPLL PFPSMEKIWD WNPLLESPKV LTQSA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-2638977165NO APICAL MERISTEM PROTEIN
1ut4_B4e-2638977165NO APICAL MERISTEM PROTEIN
1ut7_A4e-2638977165NO APICAL MERISTEM PROTEIN
1ut7_B4e-2638977165NO APICAL MERISTEM PROTEIN
4dul_A4e-2638977165NAC domain-containing protein 19
4dul_B4e-2638977165NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002443756.11e-142NAC domain-containing protein 35
RefseqXP_004973013.11e-143NAC domain-containing protein 35
TrEMBLA0A1E5V4Y21e-147A0A1E5V4Y2_9POAL; NAC domain-containing protein 35
STRINGPavir.J38855.1.p1e-146(Panicum virgatum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP77063650